1MH5: Immunoglobulin MS6-164

The Structure Of The Complex Of The Fab Fragment Of The Esterolytic Antibody MS6-164 and A Transition-State Analog. Determined by X-ray diffraction at 2.1 Å resolution. Released 23 Sept 2003.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,559
Mol. weight: 99.22 kDa
Ligands: HAL
Released: 23 Sept 2003

Explore 1MH5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MH5 contains 20 α-helices and 87 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	27C	1	3
β-strand	31	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-66	5	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	4
β-strand	114-118	5	5
β-strand	131-139	9	5
β-strand	140	1	4
β-strand	147-150	4	6
β-strand	153	1	6
β-strand	159-163	5	5
α-helix	165-167	3
β-strand	173-180	8	5
β-strand	192-195	4	6
β-strand	206-209	4	6

Chain B: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	7
β-strand	9-12	4	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	32-39	8	8
β-strand	46-52	7	8
β-strand	56-59	4	8
α-helix	61-63	3
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	84-86	3
β-strand	88-96	9	8
β-strand	101-103	3	8
β-strand	107-111	5	8
β-strand	117	1	9
β-strand	139-142	4	10
β-strand	147	1	11
β-strand	148	1	9
β-strand	172-173	2	10
α-helix	174-176	3
β-strand	177-178	2	11
β-strand	185-186	2	11
β-strand	189-192	4	10

Chain H: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	18
β-strand	9-12	4	19
β-strand	18-25	8	18
α-helix	29-31	3
β-strand	32-39	8	19
β-strand	45-52	8	19
β-strand	56-59	4	19
α-helix	61-63	3
β-strand	67-72	6	18
α-helix	73-75	3
β-strand	77-82	6	18
α-helix	84-86	3
β-strand	88-96	9	19
β-strand	101-103	3	19
β-strand	107-111	5	19
α-helix	115-116	2
β-strand	117	1	20
β-strand	139-140	2	21
β-strand	147	1	22
β-strand	148	1	20
β-strand	153-158	4	23
β-strand	166	1	23
β-strand	169-173	4	21
α-helix	174-176	3
β-strand	177-179	3	22
β-strand	184-186	3	22
β-strand	189-192	4	21
β-strand	208-211	4	23

Chain L: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	12
β-strand	10-13	4	13
β-strand	19-25	7	12
β-strand	27C	1	14
β-strand	31	1	14
β-strand	33-38	6	13
β-strand	45-49	5	13
β-strand	53-54	2	13
α-helix	55	1
β-strand	62-66	5	12
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	84-90	7	13
α-helix	96	1
β-strand	97-98	2	13
β-strand	102-106	5	13
β-strand	111	1	15
β-strand	114-118	5	16
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	16
β-strand	140	1	15
β-strand	146-150	5	17
β-strand	153	1	17
β-strand	159-163	5	16
β-strand	173-182	10	16
α-helix	183-186	4
β-strand	191-196	6	17
β-strand	205-210	6	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin MS6-164	A, L	protein	219	Mus musculus	P01837 (AlphaFold model)
Immunoglobulin MS6-164	B, H	protein	230	Mus musculus	P01863 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>1MH5_1 IMMUNOGLOBULIN MS6-164 (chains A, L)
DIVMTQAAPSVSVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLA
SGVPDRFSGSGSGTAFTLRISRVEAEDVGVYYCLQHLEYPFTFGAGTKLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B, H), FASTA

>1MH5_2 IMMUNOGLOBULIN MS6-164 (chains B, H)
QVQLQQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGNIYPDSYRTNY
NEKFKRKATLTVDTSSSTAYMQLSSLTSDDSAVYYCVRKHYSYDGVVYWGQGTLVTVSAA
KTTAPSVYPLAPVCGDTSGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCK

Ligands and cofactors

ID	Name	Formula	Copies
HAL	N-{[2-({[1-(4-carboxybutanoyl)amino]-2-phenylethyl}-hydroxyphosphinyl)oxy]acety…	C23 H29 N2 O7 P	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity. Ruzheinikov, S.N., Muranova, T.A., Sedelnikova, S.E. et al. J Mol Biol (2003) 332:423-435. DOI 10.1016/S0022-2836(03)00902-1 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1MH5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.