1MJV: Vascular Endothelial Growth Factor A

Disulfide deficient mutant of vascular endothelial growth factor A (C51A and C60A). Determined by X-ray diffraction at 2.1 Å resolution. Released 11 Dec 2002.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,751
Mol. weight: 22.39 kDa
Released: 11 Dec 2002

Explore 1MJV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MJV contains 4 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	17-24	8
β-strand	25	1	2
β-strand	27-34	8	3
α-helix	35-38	4
β-strand	46-48	3	4
β-strand	51-58	8	3
β-strand	60	1	2
β-strand	66-83	18	4
β-strand	89-106	18	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vascular Endothelial Growth Factor A	A, B	protein	96	Homo sapiens	P15692 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1MJV_1 Vascular Endothelial Growth Factor A (chains A, B)
MVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSAVPLMRCGGACNDEGLECVPTE
ESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKK

Primary citation

The cystine knot promotes folding and not thermodynamic stability in vascular endothelial growth factor. Muller, Y.A., Heiring, C., Misselwitz, R. et al. J Biol Chem (2002) 277:43410-43416. DOI 10.1074/jbc.M206438200 · PubMed

Other PDB entries of the same protein (UniProt P15692 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MKK 1.32 Å, Disulfide deficient mutant of vascular endothelial growth factor A (C61A and C104A)
9JU1 1.45 Å, Helix-loop-helix peptide (VS42-LR3) in complex with VEGF-A
9KKU 1.46 Å, Helix-loop-helix peptide (M49) in complex with VEGF-A
4GLN 1.6 Å, Crystal Structure of Chemically Synthesized Heterochiral {D-Protein Antagonist plus…
4GLS 1.6 Å, Crystal Structure of Chemically Synthesized Heterochiral {D-Protein Antagonist plus…
6ZBR 1.6 Å, VEGF-A 13:107 crystallized with 4C bicyclic peptide
6ZFL 1.6 Å, High resolution structure of VEGF-A 12:107 crystallized in tetragonal form
1FLT 1.7 Å, Vegf in complex with domain 2 of the flt-1 receptor
4KZN 1.71 Å, crystal structure of human VEGF-A receptor binding domain
4QAF 1.8 Å, Crystal structure of an engineered lipocalin (Anticalin) in complex with VEGF(8-109)
6Z13 1.8 Å, VEGF-A 13:107 crystallized with 3C bicyclic peptide
6ZCD 1.8 Å, VEGF-A 13:107 crystallized with 1C bicyclic peptide

Browse structure collections

About this viewer

MolViewer shows 1MJV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.