1MK7: Integrin BETA3-talin chimera

Crystal structure of an integrin BETA3-talin chimera. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Jan 2003.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, Gallus gallus
Chains: 4
Atoms: 3,534
Mol. weight: 47.83 kDa
Released: 28 Jan 2003

Explore 1MK7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MK7 contains 17 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	740-741	2	1
α-helix	745-748	4

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	210-224	15
α-helix	232-247	16
α-helix	262-264	3
α-helix	268-273	6
α-helix	276-284	9
α-helix	291-303	13
β-strand	311-317	7	2
β-strand	326-332	7	2
β-strand	336-341	6	2
β-strand	347-352	6	2
α-helix	353-355	3
β-strand	358-362	5	2
β-strand	365-369	5	2
β-strand	378-381	4	2
α-helix	385-399	15

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	740-741	2	2

Chain D: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	210-224	15
α-helix	232-247	16
α-helix	262-264	3
α-helix	268-273	6
α-helix	276-285	10
α-helix	291-303	13
β-strand	311-317	7	1
β-strand	326-332	7	1
β-strand	336-341	6	1
β-strand	347-352	6	1
α-helix	353-355	3
β-strand	358-362	5	1
β-strand	365-369	5	1
β-strand	378-381	4	1
α-helix	385-399	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin Beta3	A, C	protein	15	Homo sapiens	P05106 (AlphaFold model)
Talin	B, D	protein	192	Gallus gallus	P54939 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1MK7_1 Integrin Beta3 (chains A, C)
GSHMWDTANNPLYKE

Sequence of entity 2 (B, D), FASTA

>1MK7_2 TALIN (chains B, D)
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGYQCQIQFGPHNEQKHKPGFLELKDFLPK
EYIKQKGERKIFMAHKNCGNMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPR
LLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQI
AQLIAGYIDIIL

Primary citation

Structural Determinants of Integrin Recognition by Talin. Garcia-Alvarez, B., De Pereda, J.M., Calderwood, D.A. et al. Mol Cell (2003) 11:49-58. DOI 10.1016/S1097-2765(02)00823-7 · PubMed

Other PDB entries of the same protein (UniProt P05106 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MIZ 1.9 Å, Crystal structure of an integrin beta3-talin chimera
7UDH 2.0 Å, Integrin alpha IIB beta3 complex with BMS4-3
4HXJ 2.0 Å, Crystal structure of SH3:RGT complex
7UBR 2.05 Å, Integrin alpha IIB beta3 complex with GR144053
6BXJ 2.09 Å, Structure of a single-chain beta3 integrin
3T3P 2.2 Å, A Novel High Affinity Integrin alphaIIbbeta3 Receptor Antagonist That Unexpectedly…
7TMZ 2.2 Å, Integrin alpha IIB beta3 complex with BMS compound 4
2Q6W 2.25 Å, The structure of HLA-DRA, DRB3*0101 (DR52a) with bound platelet integrin peptide…
3NIG 2.25 Å, The Closed Headpiece of Integrin IIb 3 and its Complex with an IIb 3 -Specific…
7U9V 2.25 Å, Integrin alpha IIB beta3 complex with BMS4-1
3NID 2.3 Å, The Closed Headpiece of Integrin alphaIIB beta3 and its Complex with an alpahIIB beta3…
7L8P 2.35 Å, Integrin alphaIIbbeta3 in complex with sibrafiban

Browse structure collections

About this viewer

MolViewer shows 1MK7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.