E. Coli beta-hydroxydecanoyl thiol ester dehydrase modified by its classic mechanism-based inactivator, 3-decynoyl-N-acetyl cysteamine. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Jul 1996.
Explore 1MKA in 3D Show helices and sheets RCSB PDB PDBe
1MKA contains 8 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| α-helix | 9-16 | 8 | |
| α-helix | 28-30 | 3 | |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 53-59 | 7 | 1 |
| α-helix | 65-68 | 4 | |
| α-helix | 79-96 | 18 | |
| β-strand | 102-108 | 7 | 1 |
| β-strand | 111-113 | 3 | 1 |
| β-strand | 123-135 | 13 | 1 |
| β-strand | 139-149 | 11 | 1 |
| β-strand | 152-165 | 14 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 1 |
| α-helix | 9-16 | 8 | |
| α-helix | 28-30 | 3 | |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 53-59 | 7 | 1 |
| α-helix | 65-69 | 5 | |
| α-helix | 79-96 | 18 | |
| β-strand | 102-108 | 7 | 1 |
| β-strand | 110-113 | 4 | 1 |
| β-strand | 123-136 | 14 | 1 |
| β-strand | 138-149 | 12 | 1 |
| β-strand | 152-165 | 14 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-hydroxydecanoyl thiol ester dehydrase | A, B | protein | 171 | Escherichia coli | P0A6Q3 (AlphaFold model) |
>1MKA_1 BETA-HYDROXYDECANOYL THIOL ESTER DEHYDRASE (chains A, B) VDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDI NPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPT AKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF
| ID | Name | Formula | Copies |
|---|---|---|---|
| DAC | 2-decenoyl N-acetyl cysteamine | C14 H25 N O2 S | 2 |
Structure of a dehydratase-isomerase from the bacterial pathway for biosynthesis of unsaturated fatty acids: two catalytic activities in one active site. Leesong, M., Henderson, B.S., Gillig, J.R. et al. Structure (1996) 4:253-264. DOI 10.1016/S0969-2126(96)00030-5 · PubMed
Other PDB entries of the same protein (UniProt P0A6Q3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1MKA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.