1MKJ: Kinesin heavy chain

Human Kinesin Motor Domain With Docked Neck Linker. Determined by X-ray diffraction at 2.7 Å resolution. Released 30 Oct 2002.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,707
Mol. weight: 39.96 kDa
Ligands: MG, ADP
Released: 30 Oct 2002

Explore 1MKJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MKJ contains 16 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	1
α-helix	9	1
β-strand	10-15	6	2
α-helix	17-19	3
α-helix	20-24	5
β-strand	29	1	3
β-strand	32-34	3	4
β-strand	38-40	3	4
β-strand	45-47	3	4
β-strand	50-52	3	2
α-helix	58-74	17
β-strand	79-84	6	2
α-helix	91-95	5
β-strand	97	1	5
β-strand	105	1	5
α-helix	107-119	13
β-strand	126-138	13	2
β-strand	141-144	4	2
β-strand	147	1	2
β-strand	153	1	2
β-strand	154-157	4	6
β-strand	163-166	4	6
β-strand	171-173	3	2
α-helix	176-189	14
α-helix	197-203	7
β-strand	205-216	12	2
β-strand	221-231	11	2
α-helix	232-234	3
β-strand	237	1	7
β-strand	253	1	7
α-helix	256-270	15
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-290	4
β-strand	295-302	8	2
β-strand	305	1	3
α-helix	306-308	3
α-helix	309-323	15
β-strand	326-329	4	1
β-strand	333-334	2	2
α-helix	337-348	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin heavy chain	A	protein	349	Homo sapiens	P33176 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MKJ_1 KINESIN HEAVY CHAIN (chains A)
MADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKE

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Two conformations in the human kinesin power stroke defined by X-ray crystallography and EPR spectroscopy. Sindelar, C.V., Budny, M.J., Rice, S. et al. Nat Struct Biol (2002) 9:844-848. PubMed

Other PDB entries of the same protein (UniProt P33176 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1BG2 1.8 Å, Human ubiquitous kinesin motor domain
5LT1 1.95 Å, nucleotide-free kinesin-1 motor domain T92V mutant, P21 crystal form
5LT0 2.0 Å, nucleotide-free kinesin-1 motor domain, P212121 crystal form
4LNU 2.19 Å, Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin
9L7E 2.4 Å, Crystal structure of human kinesin-1 motor domain (G234A mutant) in complex with ADP
5LT3 2.59 Å, nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form
5LT2 2.6 Å, nucleotide-free kinesin-1 motor domain, P1 crystal form
9L6K 2.8 Å, Crystal structure of nucleotide-free human kinesin-1 motor domain (G234V mutant)
9L78 2.82 Å, Crystal structure of nucleotide-free human kinesin-1 motor domain (G234A mutant)
5LT4 2.88 Å, nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form
9GNQ 2.9 Å, Microtubule-associated Kif5B IAK tail mutant bound to ADP
7TR2 3.0 Å, Apo CaKip3[2-436]-L2-mutant(HsKHC) in complex with a microtubule

Browse structure collections

About this viewer

MolViewer shows 1MKJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.