9L6K: Nucleotide-free human kinesin-1 motor domain

Crystal structure of nucleotide-free human kinesin-1 motor domain (G234V mutant). Determined by X-ray diffraction at 2.8 Å resolution. Released 23 Apr 2025.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,015
Mol. weight: 76.67 kDa
Released: 23 Apr 2025

Explore 9L6K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9L6K contains 27 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	9-15	7	1
α-helix	16-19	4
α-helix	20-24	5
β-strand	29	1	2
β-strand	31-34	4	3
β-strand	38-41	4	3
β-strand	44-47	4	3
β-strand	50-52	3	1
α-helix	58-65	8
α-helix	67-73	7
β-strand	79-84	6	1
α-helix	87-89	3
α-helix	91-95	5
β-strand	97	1	4
β-strand	105	1	4
α-helix	107-121	15
β-strand	126-138	13	1
β-strand	141-144	4	1
β-strand	155-157	3	5
β-strand	163-165	3	5
β-strand	171-173	3	1
α-helix	176-187	12
β-strand	205-216	12	1
β-strand	221-231	11	1
α-helix	236-239	4
α-helix	247-269	23
α-helix	277-279	3
α-helix	281-285	5
α-helix	287-290	4
β-strand	295-302	8	1
β-strand	305	1	2
α-helix	306-308	3
α-helix	309-320	12
β-strand	330-332	3	6

Chain B: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	9-15	7	7
α-helix	16-18	3
β-strand	32-34	3	8
β-strand	38-41	4	8
β-strand	44-47	4	8
β-strand	50-52	3	7
α-helix	58-62	5
α-helix	63-67	5
α-helix	68-73	6
β-strand	79-84	6	7
α-helix	87-89	3
α-helix	91-95	5
β-strand	97	1	9
β-strand	105	1	9
α-helix	107-120	14
β-strand	126-138	13	7
β-strand	141-144	4	7
β-strand	155	1	10
β-strand	165	1	10
β-strand	171-173	3	7
α-helix	176-187	12
β-strand	205-216	12	7
β-strand	221-231	11	7
α-helix	247-269	23
α-helix	277-279	3
α-helix	281-285	5
β-strand	296-302	7	7
α-helix	311-322	12
β-strand	328-330	3	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-1 heavy chain	A, B	protein	342	Homo sapiens	P33176 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9L6K_1 Kinesin-1 heavy chain (chains A, B)
MHHHHHHADLAESNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQS
STSQEQVYNDAAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQD
IFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGATERFVS
SPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAV
SEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNA
RTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVSVNVELT

Primary citation

Tension-induced suppression of allosteric conformational changes coordinates kinesin-1 stepping. Makino, T., Kanada, R., Mori, T. et al. J Cell Biol (2025) 224. DOI 10.1083/jcb.202501253 · PubMed

Other PDB entries of the same protein (UniProt P33176 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1BG2 1.8 Å, Human ubiquitous kinesin motor domain
5LT1 1.95 Å, nucleotide-free kinesin-1 motor domain T92V mutant, P21 crystal form
5LT0 2.0 Å, nucleotide-free kinesin-1 motor domain, P212121 crystal form
4LNU 2.19 Å, Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin
9L7E 2.4 Å, Crystal structure of human kinesin-1 motor domain (G234A mutant) in complex with ADP
5LT3 2.59 Å, nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form
5LT2 2.6 Å, nucleotide-free kinesin-1 motor domain, P1 crystal form
1MKJ 2.7 Å, Human Kinesin Motor Domain With Docked Neck Linker
9L78 2.82 Å, Crystal structure of nucleotide-free human kinesin-1 motor domain (G234A mutant)
5LT4 2.88 Å, nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form
9GNQ 2.9 Å, Microtubule-associated Kif5B IAK tail mutant bound to ADP
7TR2 3.0 Å, Apo CaKip3[2-436]-L2-mutant(HsKHC) in complex with a microtubule

Browse structure collections

About this viewer

MolViewer shows 9L6K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.