1MNZ: Atomic structure of Glucose isomerase

Name: PDB 1MNZ: Atomic structure of Glucose isomerase
Published: 2002-09-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: isomerase

Atomic structure of Glucose isomerase. Determined by X-ray diffraction at 0.99 Å resolution. Released 25 Sept 2002.

Method: X-ray diffraction
Resolution: 0.99 Å
Chains: 1
Atoms: 3,505
Mol. weight: 43.59 kDa
Ligands: CA, MRD, MG
Released: 25 Sept 2002

Explore 1MNZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MNZ contains 23 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	11-14	4	1
α-helix	15-18	4
β-strand	24	1	2
β-strand	27	1	2
α-helix	32-35	4
α-helix	36-45	10
β-strand	50-52	3	1
β-strand	53-54	2	3
α-helix	55-58	4
α-helix	65-82	18
β-strand	85	1	1
β-strand	88-90	3	3
α-helix	97-99	3
α-helix	109-128	20
β-strand	133-136	4	3
β-strand	142-143	2	4
α-helix	146-148	3
α-helix	151-172	22
β-strand	177-180	4	3
β-strand	190-191	2	4
α-helix	196-203	8
α-helix	209-211	3
β-strand	212-214	3	3
β-strand	217	1	1
α-helix	218-222	5
α-helix	228-237	10
β-strand	241	1	3
β-strand	245-246	2	1
β-strand	248	1	5
β-strand	258	1	5
α-helix	259	1
β-strand	260	1	6
β-strand	262	1	6
α-helix	265-278	14
β-strand	284-286	3	1
α-helix	296-322	27
α-helix	324-332	9
α-helix	335-338	4
α-helix	347-352	6
α-helix	354-356	3
α-helix	362-367	6
α-helix	372-384	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Xylose isomerase	A	protein	388		P24300 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MNZ_1 Xylose isomerase (chains A)
MNYQPTPEDRFTFGLWTVGWQGRDPFGDATRRALDPVESVRRLAELGAHGVTFHDDDLIP
FGSSDSEREEHVKRFRQALDDTGMKVPMATTNLFTHPVFKDGGFTANDRDVRRYALRKTI
RNIDLAVELGAETYVAWGGREGAESGGAKDVRDALDRMKEAFDLLGEYVTSQGYDIRFAI
EPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK
LFHIDLNGQNGIKYDQDLRFGAGDLRAAFWLVDLLESAGYSGPRHFDFKPPRTEDFDGVW
ASAAGCMRNYLILKERAAAFRADPEVQEALRASRLDELARPTAADGLQALLDDRSAFEEF
DVDAAAARGMAFERLDQLAMDHLLGARG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
MRD	(4R)-2-methylpentane-2,4-diol	C6 H14 O2	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (TRS) are not listed.

Primary citation

Atomic structure of Glucose isomerase. Nowak, E., Panjikar, S., Tucker, P.A. To be published.

Other PDB entries of the same protein (UniProt P24300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AVH 0.9 Å, The 0.90 angstrom structure (I222) of glucose isomerase crystallized in high-strength…
2GLK 0.94 Å, High-resolution study of D-Xylose isomerase, 0.94A resolution.
4A8I 0.95 Å, Protein crystallization and microgravity: glucose isomerase crystals grown during the…
3U3H 0.97 Å, X-Ray Crystallographic Analysis of D-Xylose Isomerase-Catalyzed Isomerization of…
7DMM 0.99 Å, Structure of a glucose isomerase crystal grown in an aqueous glycerol solution without…
8WDG 0.99 Å, Subatomic crystal structure of glucose isomerase from Streptomyces rubiginosus
5AVN 1.03 Å, The 1.03 angstrom structure (P212121) of glucose isomerase crystallized in high-strength…
6YBO 1.06 Å, RT structure of Glucose Isomerase obtained at 1.06 A resolution from crystal grown in a…
9SO8 1.09 Å, Glucose/ xylose isomerase under 100 MPa
6QRR 1.1 Å, X-ray radiation dose series on xylose isomerase - 0.13 MGy
6QRS 1.17 Å, X-ray radiation dose series on xylose isomerase - 0.13 MGy
6QRT 1.17 Å, X-ray radiation dose series on xylose isomerase - 1.38 MGy

Browse structure collections

About this viewer

MolViewer shows 1MNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.