1MSO: T6 Human Insulin

T6 Human Insulin at 1.0 A Resolution. Determined by X-ray diffraction at 1.0 Å resolution. Released 4 Mar 2003.

Method: X-ray diffraction
Resolution: 1.0 Å
Chains: 4
Atoms: 1,103
Mol. weight: 11.77 kDa
Ligands: ZN
Released: 4 Mar 2003

Explore 1MSO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MSO contains 10 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
β-strand	11	1	1
α-helix	13-17	5
β-strand	20	1	2

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
α-helix	9-19	11
α-helix	20-22	3
β-strand	24-26	3	2

Chain C: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	2	1
α-helix	3-8	6
α-helix	13-16	4
α-helix	17-19	3
β-strand	20	1	2

Chain D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	20-22	3
β-strand	24-26	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin A-Chain	A, C	protein	21		P01308 (AlphaFold model)
Insulin B-Chain	B, D	protein	30		P01308 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1MSO_1 Insulin A-Chain (chains A, C)
GIVEQCCTSICSLYQLENYCN

Sequence of entity 2 (B, D), FASTA

>1MSO_2 Insulin B-Chain (chains B, D)
FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

The structure of T6 human insulin at 1.0 A resolution. Smith, G.D., Pangborn, W.A., Blessing, R.H. Acta Crystallogr D Biol Crystallogr (2003) 59:474-482. DOI 10.1107/S0907444902023685 · PubMed

Other PDB entries of the same protein (UniProt P01308 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3W7Y 0.92 Å, 0.92A structure of 2Zn human insulin at 100K
5E7W 0.95 Å, X-ray Structure of Human Recombinant 2Zn insulin at 0.92 Angstrom
5HQI 0.97 Å, Insulin with proline analog HzP at position B28 in the T2 state
3HYD 1.0 Å, LVEALYL peptide derived from human insulin chain B, residues 11-17
6VER 1.05 Å, Human insulin analog: [GluB10,TyrB20]-DOI
4FKA 1.08 Å, High resolution structure of the manganese derivative of insulin
3TT8 1.12 Å, Crystal Structure Analysis of Cu Human Insulin Derivative
3W7Z 1.15 Å, 1.15A structure of human 2Zn insulin at 293K
8OKY 1.17 Å, Crystal structure of D-ProB26-DTriA analogue of human insulin
5USP 1.17 Å, Insulin with proline analog Pip at position B28 in the T2 state
5UOZ 1.17 Å, Insulin with proline analog FyP at position B28 in the T2 state
5URT 1.18 Å, Insulin with proline analog DhP at position B28 in the T2 state

Browse more

1MSO is part of these collections:

Insulin and hormones

About this viewer

MolViewer shows 1MSO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.