1MUJ: Murine class II MHC I-Ab

Crystal structure of murine class II MHC I-Ab in complex with a human CLIP peptide. Determined by X-ray diffraction at 2.15 Å resolution. Released 18 Feb 2003.

Method: X-ray diffraction
Resolution: 2.15 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 3,311
Mol. weight: 48.76 kDa
Ligands: NAG
Released: 18 Feb 2003

Explore 1MUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MUJ contains 16 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-15	12	1
β-strand	19-26	8	1
β-strand	29-35	7	1
β-strand	40-43	4	1
α-helix	46-49	4
β-strand	52-53	2	2
α-helix	56-76	21
α-helix	79-83	5
α-helix	85-87	3
β-strand	88-93	6	3
β-strand	103-112	10	3
β-strand	118-123	6	4
β-strand	127	1	4
β-strand	132-134	3	3
α-helix	137	1
β-strand	138-139	2	3
β-strand	145-153	9	3
β-strand	161-166	6	4
β-strand	174-178	5	4
α-helix	180-182	3

Chain B: 9 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	7-18	12	1
β-strand	23-32	10	1
β-strand	35-41	7	1
β-strand	47-48	2	1
α-helix	52-54	3
α-helix	55-62	8
α-helix	65-74	10
α-helix	75-80	6
α-helix	81-82	2
α-helix	83-86	5
α-helix	87-88	2
α-helix	90-92	3
β-strand	95	1	5
α-helix	96-97	2
β-strand	98-103	6	6
β-strand	114-122	9	6
β-strand	123	1	5
β-strand	128-133	6	7
β-strand	136-138	3	7
β-strand	142-144	3	6
β-strand	148-149	2	6
β-strand	155-162	8	6
β-strand	171-176	6	7
β-strand	184-188	5	7

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	89-90	2	2
α-helix	96-100	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H-2 class II histocompatibility antigen, a-B alpha chain	A	protein	190	Mus musculus	P14434 (AlphaFold model)
H-2 class II histocompatibility antigen, a beta chain	B	protein	197	Mus musculus	P14483 (AlphaFold model)
CLIP peptide	C	protein	36	Homo sapiens	P04233 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1MUJ_1 H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, A-B ALPHA CHAIN (chains A)
EDDIEADHVGTYGISVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFGQLASFDP
QGGLQNIAVVKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPV
INITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLK
HWSSADLVPR

Sequence of entity 2 (B), FASTA

>1MUJ_2 H-2 CLASS II HISTOCOMPATIBILITY ANTIGEN, A BETA CHAIN (chains B)
GDSERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEY
WNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSV
TDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPS
LKSPITVEWSSAELVPR

Sequence of entity 3 (C), FASTA

>1MUJ_3 CLIP peptide (chains C)
GSHSRGLPKPPKPVSKMRMATPLLMQALPMGSGSGS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Crystal structure of MHC class II I-Ab in complex with a human CLIP peptide: Prediction of an I-Ab peptide-binding motif. Zhu, Y., Rudensky, A.Y., Teyton, A.L. et al. J Mol Biol (2003) 326:1157-1174. DOI 10.1016/S0022-2836(02)01437-7 · PubMed

Other PDB entries of the same protein (UniProt P14434 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VQ8 2.01 Å, Immune receptor complex
8RAL 2.1 Å, CL3E peptide bound to the I-Ab murine MHC class II receptor
4P23 2.25 Å, J809.B5 TCR bound to IAb/3K
1LNU 2.5 Å, Crystal structure of class II MHC molecule iab bound to EALPHA3K peptide
3C5Z 2.55 Å, Crystal structure of mouse MHC class II I-Ab/3K peptide complexed with mouse TCR B3K506
6MNG 2.66 Å, 4738 TCR bound to IAb Padi4
3RDT 2.7 Å, Crystal Structure of 809.B5 TCR complexed with MHC Class II I-Ab/3k peptide
6MNN 2.83 Å, 6236 TCR bound to I-Ab Padi4
4P46 2.85 Å, J809.B5 Y31A TCR bound to IAb3K
6MNO 2.9 Å, 6235 TCR bound to I-Ab Padi4
9AUD 2.9 Å, Immune receptor complex
3C60 3.05 Å, Crystal structure of mouse MHC class II I-Ab/3K peptide complexed with mouse TCR YAe62

Browse structure collections

About this viewer

MolViewer shows 1MUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.