1N2Z: Vitamin B12 transport protein btuF

Name: PDB 1N2Z: 2.0 Angstrom structure of BtuF, the vitamin B12 binding protein of E. coli
Published: 2002-12-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transport protein

2.0 Angstrom structure of BtuF, the vitamin B12 binding protein of E. coli. Determined by X-ray diffraction at 2.0 Å resolution. Released 18 Dec 2002.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Escherichia coli
Chains: 2
Atoms: 4,416
Mol. weight: 59.69 kDa
Ligands: CD, CNC
Released: 18 Dec 2002

Explore 1N2Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N2Z contains 32 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	23-25	3
β-strand	26-28	3	1
α-helix	31-39	9
β-strand	46	1	1
β-strand	47-48	2	2
α-helix	55-59	5
α-helix	61	1
β-strand	62-65	4	2
β-strand	68-69	2	2
α-helix	71-76	6
β-strand	81-84	4	1
α-helix	91-100	10
β-strand	104-106	3	1
α-helix	112-122	11
α-helix	123-125	3
α-helix	129-150	22
α-helix	154-155	2
β-strand	156-160	5	3
β-strand	162	1	4
β-strand	168	1	4
α-helix	175-182	8
β-strand	185-187	3	3
β-strand	198	1	4
α-helix	201-205	5
β-strand	211-215	5	3
α-helix	218-220	3
α-helix	221-228	8
β-strand	236-239	4	3
α-helix	241-245	5
α-helix	251-262	12

Chain B: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	23-25	3
β-strand	26-28	3	5
α-helix	31-39	9
β-strand	46	1	5
β-strand	47-48	2	6
α-helix	55-59	5
α-helix	61	1
β-strand	62-65	4	6
β-strand	68-69	2	6
α-helix	71-76	6
β-strand	81-84	4	5
α-helix	91-99	9
β-strand	104-106	3	5
α-helix	112-122	11
α-helix	123-125	3
α-helix	129-150	22
α-helix	153-155	3
β-strand	156-160	5	7
β-strand	162	1	8
β-strand	168	1	8
α-helix	175-182	8
β-strand	185-187	3	7
β-strand	198	1	8
α-helix	201-206	6
β-strand	211-215	5	7
α-helix	218-220	3
α-helix	221-228	8
β-strand	236-239	4	7
α-helix	241-245	5
α-helix	251-263	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vitamin B12 transport protein btuF	A, B	protein	245	Escherichia coli	P37028 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1N2Z_1 Vitamin B12 transport protein btuF (chains A, B)
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDL
VIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLD
QYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSR
EQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNA
LSQVD

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	22
CNC	Cyanocobalamin	C63 H89 Co N14 O14 P	2

Water and common crystallization additives (CL, PG4) are not listed.

Primary citation

The structure of Escherichia coli BtuF and binding to its cognate ATP binding cassette transporter. Borths, E.L., Locher, K.P., Lee, A.T. et al. Proc Natl Acad Sci U S A (2002) 99:16642-16647. DOI 10.1073/pnas.262659699 · PubMed

Other PDB entries of the same protein (UniProt P37028 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M29 1.5 Å, Structure of cobinamide-bound BtuF, the periplasmic vitamin B12 binding protein in E.coli
5M3B 1.5 Å, Structure of cobinamide-bound BtuF mutant W66L, the periplasmic vitamin B12 binding…
5M34 1.6 Å, Structure of cobinamide-bound BtuF mutant W66Y, the periplasmic vitamin B12 binding…
5M2Q 1.7 Å, Structure of cobinamide-bound BtuF mutant W66F, the periplasmic vitamin B12 binding…
1N4A 2.0 Å, The Ligand Bound Structure of E.coli BtuF, the Periplasmic Binding Protein for Vitamin B12
2QI9 2.6 Å, ABC-transporter BtuCD in complex with its periplasmic binding protein BtuF
5OVW 2.65 Å, Nanobody-bound BtuF, the vitamin B12 binding protein in Escherichia coli
1N4D 3.0 Å, The Ligand-Free Structure of E coli BtuF, the Periplasmic Binding Protein for Vitamin B12
4FI3 3.47 Å, Structure of vitamin B12 transporter BtuCD-F in a nucleotide-bound state
4DBL 3.49 Å, Crystal structure of E159Q mutant of BtuCDF

Browse structure collections

About this viewer

MolViewer shows 1N2Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.