1N4Y: Kistrin

Refined structure of kistrin. Determined by solution NMR. Released 28 Jan 2003.

Method: Solution NMR
Organism: Calloselasma rhodostoma
Chains: 1
Atoms: 500
Mol. weight: 7.34 kDa
Released: 28 Jan 2003

Explore 1N4Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N4Y contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	14	1	1
β-strand	21	1	1
β-strand	33-34	2	2
β-strand	37-38	2	2
α-helix	39-40	2
β-strand	44-46	3	3
α-helix	52-54	3
β-strand	55-56	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kistrin	A	protein	68	Calloselasma rhodostoma	P30403 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1N4Y_1 KISTRIN (chains A)
GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFSRAGKICRIPRGDMPDDRCTGQ
SADCPRYH

Primary citation

Solution structure of kistrin, a potent platelet aggregation inhibitor and GP IIb-IIIa antagonist. Adler, M., Lazarus, R.A., Dennis, M.S. et al. Science (1991) 253:445-448. PubMed

Other PDB entries of the same protein (UniProt P30403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4R5R 0.96 Å, Crystal structure of Rhodostomin KKKRT mutant
3UCI 1.35 Å, Crystal structure of Rhodostomin ARLDDL mutant
7X4V 1.38 Å, Crystal structure of Rhodostomin ARGDDP mutant
7X4Z 1.48 Å, Crystal structure of Rhodostomin ARGDWP mutant
4RQG 1.66 Å, Crystal structure of Rhodostomin
7X4S 1.8 Å, Crystal structure of Rhodostomin ARGDMP mutant
26QZ 1.8 Å, Crystal structure of Rhodostomin ARGDP mutant
4R5U 1.81 Å, Crystal structure of Rhodostomin R46E mutant
9IUJ 2.78 Å, Integrin alpha-v beta-3 in complex with rhodostomin
1Q7I Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif
1Q7J Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif
2LJV Solution structure of Rhodostomin G50L mutant

Browse structure collections

About this viewer

MolViewer shows 1N4Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.