4R5R: Rhodostomin KKKRT mutant

Crystal structure of Rhodostomin KKKRT mutant. Determined by X-ray diffraction at 0.96 Å resolution. Released 26 Aug 2015.

Method: X-ray diffraction
Resolution: 0.96 Å
Organism: Calloselasma rhodostoma
Chains: 2
Atoms: 1,287
Mol. weight: 14.97 kDa
Released: 26 Aug 2015

Explore 4R5R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4R5R contains 6 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	14	1	2
β-strand	21	1	2
α-helix	22	1
β-strand	33-34	2	3
β-strand	37-38	2	3
α-helix	39-40	2
β-strand	44-46	3	4
α-helix	52-54	3
β-strand	55-56	2	4

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	14	1	5
β-strand	21	1	5
α-helix	22	1
β-strand	33-34	2	6
β-strand	37-38	2	6
α-helix	39-40	2
β-strand	44-46	3	7
β-strand	53	1	1
α-helix	54	1
β-strand	55-56	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disintegrin rhodostomin	A, B	protein	68	Calloselasma rhodostoma	P30403 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4R5R_1 Disintegrin rhodostomin (chains A, B)
GKECDCSSPENPCCDAATCKLRPGAQCGEGLCCEQCKFKKKRTICRIPRGDMPDDRCTGQ
SADCPRYH

Primary citation

Effects of the regions adjacent to the RGD motif in disintegrins on their inhibitory activities and structures. Huang, C.H., Shiu, J.H., Chang, Y.T. et al. To be published.

Other PDB entries of the same protein (UniProt P30403 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UCI 1.35 Å, Crystal structure of Rhodostomin ARLDDL mutant
7X4V 1.38 Å, Crystal structure of Rhodostomin ARGDDP mutant
7X4Z 1.48 Å, Crystal structure of Rhodostomin ARGDWP mutant
4RQG 1.66 Å, Crystal structure of Rhodostomin
7X4S 1.8 Å, Crystal structure of Rhodostomin ARGDMP mutant
26QZ 1.8 Å, Crystal structure of Rhodostomin ARGDP mutant
4R5U 1.81 Å, Crystal structure of Rhodostomin R46E mutant
9IUJ 2.78 Å, Integrin alpha-v beta-3 in complex with rhodostomin
1N4Y Refined structure of kistrin
1Q7I Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif
1Q7J Structural Analysis of Integrin alpha IIb beta 3- Disintegrin with the AKGDWN Motif
2LJV Solution structure of Rhodostomin G50L mutant

Browse structure collections

About this viewer

MolViewer shows 4R5R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.