1N83: Nuclear receptor ROR-alpha

Crystal Structure of the complex between the Orphan Nuclear Hormone Receptor ROR(alpha)-LBD and Cholesterol. Determined by X-ray diffraction at 1.63 Å resolution. Released 11 Dec 2002.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,513
Mol. weight: 31.9 kDa
Ligands: CLR
Released: 11 Dec 2002

Explore 1N83 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N83 contains 14 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	262-286	25
α-helix	292-297	6
β-strand	302	1	1
α-helix	303-304	2
α-helix	305-313	9
α-helix	316-340	25
α-helix	349-367	19
α-helix	368-371	4
β-strand	372-373	2	1
β-strand	378-381	4	1
β-strand	384-386	3	1
α-helix	388-394	7
α-helix	397-411	15
α-helix	417-428	12
α-helix	439-460	22
α-helix	466-494	29
α-helix	496-502	7
α-helix	505-510	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor ROR-alpha	A	protein	270	Homo sapiens	P35398 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1N83_1 Nuclear receptor ROR-alpha (chains A)
GSSHHHHHHLEVLFQGPAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQN
KQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFD
SQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADR
SWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKA
IYPDIVRLHFPPLYKELFTSEFEPAMQIDG

Ligands and cofactors

ID	Name	Formula	Copies
CLR	Cholesterol	C27 H46 O	1

Primary citation

X-ray Structure of hROR(alpha) LBD at 1.63A: Structural and Functional data that Cholesterol or a Cholesterol derivative is the natural ligand of ROR(alpha). Kallen, J.A., Schlaeppi, J.M., Bitsch, F. et al. Structure (2002) 10:1697-1702. DOI 10.1016/S0969-2126(02)00912-7 · PubMed

Other PDB entries of the same protein (UniProt P35398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4S15 1.9 Å, Crystal structure of the orphan nuclear receptor RORalpha ligand-binding domain in…
1S0X 2.2 Å, Crystal structure of the human RORalpha ligand binding domain in complex with…

Browse structure collections

About this viewer

MolViewer shows 1N83 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.