Horse Liver Alcohol Dehydrogenase Val292Thr Mutant Complexed to NAD+ and Pyrazole. Determined by X-ray diffraction at 1.13 Å resolution. Released 4 Feb 2003.
Explore 1N8K in 3D Show helices and sheets RCSB PDB PDBe
1N8K contains 46 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-14 | 8 | 1 |
| β-strand | 22-28 | 7 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 35-44 | 10 | 2 |
| α-helix | 47-54 | 8 | |
| β-strand | 63-64 | 2 | 1 |
| β-strand | 69-76 | 8 | 2 |
| β-strand | 88-91 | 4 | 2 |
| α-helix | 101-104 | 4 | |
| β-strand | 130-132 | 3 | 1 |
| β-strand | 135-138 | 4 | 1 |
| β-strand | 147 | 1 | 1 |
| β-strand | 149-153 | 5 | 2 |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 2 |
| α-helix | 166-169 | 4 | |
| α-helix | 170-173 | 4 | |
| α-helix | 175-181 | 7 | |
| α-helix | 182-187 | 6 | |
| β-strand | 194-198 | 5 | 3 |
| α-helix | 202-213 | 12 | |
| β-strand | 218-222 | 5 | 3 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-235 | 7 | |
| β-strand | 239-241 | 3 | 3 |
| α-helix | 243-245 | 3 | |
| α-helix | 250-257 | 8 | |
| β-strand | 262 | 1 | 4 |
| β-strand | 264-267 | 4 | 3 |
| α-helix | 272-281 | 10 | |
| β-strand | 282 | 1 | 4 |
| β-strand | 288-291 | 4 | 3 |
| α-helix | 294-296 | 3 | |
| α-helix | 299-300 | 2 | |
| β-strand | 301-303 | 3 | 5 |
| α-helix | 306-309 | 4 | |
| β-strand | 313-316 | 4 | 3 |
| α-helix | 319-321 | 3 | |
| α-helix | 324-336 | 13 | |
| α-helix | 343-345 | 3 | |
| β-strand | 346-351 | 6 | 2 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-363 | 9 | |
| β-strand | 369-373 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6 | 1 | |
| β-strand | 7-13 | 7 | 6 |
| β-strand | 14 | 1 | 7 |
| α-helix | 20-21 | 2 | |
| β-strand | 22-28 | 7 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 35-44 | 10 | 8 |
| α-helix | 47-54 | 8 | |
| β-strand | 63 | 1 | 7 |
| β-strand | 68-76 | 9 | 8 |
| β-strand | 88-91 | 4 | 8 |
| α-helix | 101-104 | 4 | |
| β-strand | 130-132 | 3 | 6 |
| β-strand | 135-137 | 3 | 6 |
| β-strand | 138 | 1 | 7 |
| β-strand | 147 | 1 | 6 |
| β-strand | 149-153 | 5 | 8 |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 8 |
| α-helix | 166-169 | 4 | |
| α-helix | 170-173 | 4 | |
| α-helix | 175-181 | 7 | |
| α-helix | 182-187 | 6 | |
| β-strand | 194-198 | 5 | 3 |
| α-helix | 202-213 | 12 | |
| β-strand | 218-222 | 5 | 3 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-235 | 7 | |
| β-strand | 239-241 | 3 | 3 |
| α-helix | 243-245 | 3 | |
| α-helix | 250-257 | 8 | |
| β-strand | 262 | 1 | 9 |
| β-strand | 264-267 | 4 | 3 |
| α-helix | 272-281 | 10 | |
| β-strand | 282 | 1 | 9 |
| β-strand | 288-291 | 4 | 3 |
| α-helix | 294-296 | 3 | |
| α-helix | 299-300 | 2 | |
| β-strand | 301-303 | 3 | 5 |
| α-helix | 306-309 | 4 | |
| β-strand | 313-316 | 4 | 3 |
| α-helix | 319-321 | 3 | |
| α-helix | 324-336 | 13 | |
| α-helix | 343-345 | 3 | |
| β-strand | 346-351 | 6 | 8 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-363 | 9 | |
| β-strand | 369-373 | 5 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alcohol Dehydrogenase E chain | A, B | protein | 374 | Equus caballus | P00327 (AlphaFold model) |
>1N8K_1 Alcohol Dehydrogenase E chain (chains A, B) STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTP LPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPR GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGY GSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVITGVPPDSQN LSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD LLRSGESIRTILTF
| ID | Name | Formula | Copies |
|---|---|---|---|
| PZO | Pyrazole | C3 H4 N2 | 2 |
| NAJ | Nicotinamide-adenine-dinucleotide (acidic form) | C21 H27 N7 O14 P2 | 2 |
| ZN | Zinc ion | Zn | 4 |
Water and common crystallization additives (MPD) are not listed.
Amino Acid Residues in the Nicotinamide Binding Site Contribute to Catalysis by Horse Liver Alcohol Dehydrogenase. Rubach, J.K., Plapp, B.V. Biochemistry (2003) 42:2907-2915. DOI 10.1021/bi0272656 · PubMed
Other PDB entries of the same protein (UniProt P00327 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1N8K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.