1NGW: Chimeric Affinity Matured Fab 7g12

Chimeric Affinity Matured Fab 7g12 complexed with mesoporphyrin. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Feb 2003.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 6,645
Mol. weight: 94.22 kDa
Ligands: MMP
Released: 4 Feb 2003

Explore 1NGW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NGW contains 27 α-helices and 92 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	12
β-strand	10-14	5	13
β-strand	19-24	6	12
β-strand	30	1	14
β-strand	33-38	6	13
β-strand	45-49	5	13
β-strand	53-54	2	13
α-helix	55	1
β-strand	62-67	6	12
β-strand	68	1	14
β-strand	70-75	6	12
α-helix	80-82	3
β-strand	84-90	7	13
α-helix	96	1
β-strand	97-98	2	13
β-strand	102-107	6	13
β-strand	111	1	15
α-helix	112-113	2
β-strand	114-118	5	16
α-helix	119-121	3
α-helix	122-126	5
β-strand	130-139	10	16
β-strand	140	1	15
β-strand	144-150	7	17
β-strand	153-154	2	17
β-strand	159-163	5	16
α-helix	164-167	4
β-strand	173-181	9	16
α-helix	183-188	6
β-strand	191-198	8	17
β-strand	205-210	6	17

Chains B and H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	18
β-strand	10-12	3	19
β-strand	18-20	3	18
β-strand	22-25	4	18
β-strand	34-38	5	19
β-strand	46-51	6	19
β-strand	58-60	3	19
β-strand	68-73	6	18
β-strand	78-83	6	18
α-helix	88-90	3
β-strand	92-98	7	19
β-strand	104	1	19
β-strand	108-112	5	19
β-strand	118	1	20
α-helix	119-120	2
β-strand	121-125	5	21
β-strand	136-146	11	21
β-strand	147	1	20
β-strand	152-155	4	22
α-helix	156-158	3
β-strand	160	1	22
β-strand	164-166	3	21
α-helix	167-169	3
β-strand	170-171	2	21
β-strand	177-186	10	21
α-helix	187-189	3
β-strand	195-201	7	22
α-helix	202-204	3
β-strand	206-212	7	22

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	10-14	5	2
β-strand	19-24	6	1
β-strand	30	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-65	4	1
β-strand	68	1	3
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-107	6	2
β-strand	111	1	4
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-126	5
β-strand	130-139	10	5
β-strand	140	1	4
β-strand	144-150	7	6
β-strand	153-154	2	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-181	9	5
α-helix	183-188	6
β-strand	191-198	8	6
β-strand	205-210	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mature Metal Chelatase Catalytic Antibody, Light chain	A, L	protein	213	Mus musculus, Homo sapiens
Mature Metal Chelatase Catalytic Antibody, Heavy chain	B, H	protein	216	Mus musculus, Homo sapiens	P06328 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>1NGW_1 Mature Metal Chelatase Catalytic Antibody, Light chain (chains A, L)
ELVMTQTPKFMSTTVGDRVSITCKASQNVGTPVAWYQQKPGQSPKLLIYSASNRYTGVPD
RFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSYPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRNE

Sequence of entity 2 (B, H), FASTA

>1NGW_2 Mature Metal Chelatase Catalytic Antibody, Heavy chain (chains B, H)
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGMIDPNSGGTKY
NEKFKSKATLTVDKPSNTAYMQLSSLTSEDSAVYYCTRRDMDYWGAGTTVTVSSASTKGP
SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKIVPKS

Ligands and cofactors

ID	Name	Formula	Copies
MMP	N-methylmesoporphyrin	C35 H40 N4 O4	2

Primary citation

Structural evidence for substrate strain in antibody catalysis. Yin, J., Andryski, S.E., Beuscher IV, A.E. et al. Proc Natl Acad Sci U S A (2003) 100:856-861. DOI 10.1073/pnas.0235873100 · PubMed

Other PDB entries of the same protein (UniProt P06328 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NGZ 1.6 Å, Chimeric Germline Fab 7g12-apo
8EMA 8.2 Å, mouse full length B cell receptor

Browse structure collections

About this viewer

MolViewer shows 1NGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.