1NGZ: Chimeric Germline Fab 7g12-apo

Chimeric Germline Fab 7g12-apo. Determined by X-ray diffraction at 1.6 Å resolution. Released 4 Feb 2003.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,753
Mol. weight: 46.85 kDa
Released: 4 Feb 2003

Explore 1NGZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NGZ contains 17 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-66	5	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-154	2	5
α-helix	155	1
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-188	6
β-strand	191-197	7	5
β-strand	205-210	6	5

Chain B: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
β-strand	9-12	4	2
β-strand	18-25	8	6
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	68-73	6	6
α-helix	74-76	3
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-97	6	2
β-strand	108-112	5	2
β-strand	118	1	7
α-helix	119-120	2
β-strand	121-125	5	8
β-strand	136-146	11	8
β-strand	147	1	7
β-strand	152-155	4	9
α-helix	156-158	3
β-strand	160	1	9
β-strand	164-166	3	8
α-helix	167-169	3
β-strand	170-171	2	8
β-strand	177-186	10	8
α-helix	187-189	3
β-strand	195-201	7	9
α-helix	202-204	3
β-strand	206-212	7	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Germline Metal Chelatase Catalytic Antibody, Light chain	A	protein	213	Mus musculus, Homo sapiens	P01834 (AlphaFold model)
Germline Metal Chelatase Catalytic Antibody, Heavy chain	B	protein	220	Mus musculus, Homo sapiens	P06328 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NGZ_1 Germline Metal Chelatase Catalytic Antibody, Light chain (chains A)
ELVMTQTPKFMSTSVGDRVSITCKASQNVGTAVAWYQQKPGQSPKLLIYSASNRYTGVPD
RFTGSGSGTDFTLTISNMQSEDLADYFCQQYSSYPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE

Sequence of entity 2 (B), FASTA

>1NGZ_2 Germline Metal Chelatase Catalytic Antibody, Heavy chain (chains B)
QVQLLESGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNSGGTKY
NEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCTRRDSDYWGAGTTVTVSSASTKGP
SVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT

Primary citation

Structural evidence for substrate strain in antibody catalysis. Yin, J., Andryski, S.A., Beuscher, A.B. et al. Proc Natl Acad Sci U S A (2003) 100:856-861. DOI 10.1073/pnas.0235873100 · PubMed

Other PDB entries of the same protein (UniProt P01834 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EWI 1.6 Å, Crystal Structure of the Human Fab VRC38.01, an HIV-1 V1V2-Directed Neutralizing…
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement
4XMP 1.78 Å, Crystal structure of broadly and potently neutralizing antibody VRC08 in complex with…
1N0X 1.8 Å, Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a…
3VH8 1.8 Å, KIR3DL1 in complex with HLA-B*5701
3X12 1.8 Å, Crystal structure of HLA-B*57:01.I80N
6B9Z 1.82 Å, Trastuzumab Fab v3
2VXQ 1.9 Å, Crystal structure of the major grass pollen allergen Phl p 2 in complex with its…
3D85 1.9 Å, Crystal structure of IL-23 in complex with neutralizing FAB
6BAH 1.9 Å, Trastuzumab Fab v3 with 5-diphenyl meditope variant
6DCV 1.9 Å, Crystal structure of human anti-tau antibody CBTAU-27.1
1GAF 1.95 Å, 48G7 hybridoma line FAB complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic…

Browse structure collections

About this viewer

MolViewer shows 1NGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.