3D85: IL-23

Crystal structure of IL-23 in complex with neutralizing FAB. Determined by X-ray diffraction at 1.9 Å resolution. Released 2 Sept 2008.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,509
Mol. weight: 102.03 kDa
Released: 2 Sept 2008

Explore 3D85 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3D85 contains 35 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
β-strand	62-66	5	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	144-150	7	5
β-strand	153-154	2	5
α-helix	155	1
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-188	6
β-strand	191-198	8	5
β-strand	205-210	6	5

Chain B: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-52	8	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	65	1	6
β-strand	68-73	6	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-98	7	2
α-helix	100-102	3
β-strand	105	1	2
β-strand	109-113	5	2
α-helix	117-118	2
β-strand	119	1	7
α-helix	120-121	2
β-strand	122-126	5	8
α-helix	127-129	3
β-strand	137-147	11	8
β-strand	148	1	7
β-strand	153-156	4	9
α-helix	157-159	3
β-strand	161	1	9
β-strand	165-167	3	8
α-helix	168-170	3
β-strand	171-172	2	8
β-strand	178-187	10	8
α-helix	188-190	3
β-strand	197-202	6	9
α-helix	203-205	3
β-strand	207-212	6	9

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	11-26	16
α-helix	54-56	3
α-helix	60-65	6
α-helix	68-85	18
α-helix	88-91	4
α-helix	95-97	3
α-helix	102-116	15
α-helix	133-135	3
α-helix	136-167	32

Chain D: 5 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	10
β-strand	8-14	7	10
β-strand	22-27	6	11
β-strand	37-40	4	10
β-strand	48-49	2	10
β-strand	52-57	6	11
α-helix	60-62	3
β-strand	64-70	7	10
β-strand	73-86	14	10
β-strand	89-90	2	10
α-helix	96-97	2
β-strand	108-110	3	10
β-strand	111	1	12
β-strand	117-124	8	10
β-strand	130-138	9	10
β-strand	144-148	5	10
β-strand	152-158	7	10
β-strand	163-173	11	10
β-strand	186-194	9	10
β-strand	197-205	9	10
α-helix	207-210	4
β-strand	211	1	12
α-helix	213-216	4
β-strand	217-223	7	13
β-strand	230-235	6	13
β-strand	249-256	8	14
β-strand	266-269	4	14
β-strand	273-276	4	13
β-strand	283-290	8	14
α-helix	296-300	5
β-strand	301-304	4	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FAB of antibody 7G10, light chain	A	protein	214	Homo sapiens	P01834 (AlphaFold model)
FAB of antibody 7G10, heavy chain	B	protein	223	Homo sapiens	P01857 (AlphaFold model)
Interleukin-23 subunit p19	C	protein	178	Homo sapiens	Q9NPF7 (AlphaFold model)
Interleukin-12 subunit p40	D	protein	306	Homo sapiens	P29460 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3D85_1 FAB of antibody 7G10, light chain (chains A)
DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYRQKSHESPRLLIKYASQSISGIPS
RFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPFTFGSGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (B), FASTA

>3D85_2 FAB of antibody 7G10, heavy chain (chains B)
EVQLQQSGPELVKPGASVKMSCKASGYTFTSNVMHWVKQKPGQGLEWIGYINPYNDGTKY
NEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCARNWDVAYWGQGTLVTVSAASTKG
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 3 (C), FASTA

>3D85_3 Interleukin-23 subunit p19 (chains C)
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDP
QGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEG
HHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPGSHHHHHH

Sequence of entity 4 (D), FASTA

>3D85_4 Interleukin-12 subunit p40 (chains D)
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEF
GDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTC
WWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAA
EESLPIEVMVDAVHKLKYEQYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTW
STPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEW
ASVPCS

Primary citation

Crystal structures of the pro-inflammatory cytokine interleukin-23 and its complex with a high-affinity neutralizing antibody. Beyer, B.M., Ingram, R., Ramanathan, L. et al. J Mol Biol (2008) 382:942-955. DOI 10.1016/j.jmb.2008.08.001 · PubMed

Other PDB entries of the same protein (UniProt P01834 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EWI 1.6 Å, Crystal Structure of the Human Fab VRC38.01, an HIV-1 V1V2-Directed Neutralizing…
1NGZ 1.6 Å, Chimeric Germline Fab 7g12-apo
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement
4XMP 1.78 Å, Crystal structure of broadly and potently neutralizing antibody VRC08 in complex with…
1N0X 1.8 Å, Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a…
3VH8 1.8 Å, KIR3DL1 in complex with HLA-B*5701
3X12 1.8 Å, Crystal structure of HLA-B*57:01.I80N
6B9Z 1.82 Å, Trastuzumab Fab v3
2VXQ 1.9 Å, Crystal structure of the major grass pollen allergen Phl p 2 in complex with its…
6BAH 1.9 Å, Trastuzumab Fab v3 with 5-diphenyl meditope variant
6DCV 1.9 Å, Crystal structure of human anti-tau antibody CBTAU-27.1
1GAF 1.95 Å, 48G7 hybridoma line FAB complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic…

Browse structure collections

About this viewer

MolViewer shows 3D85 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.