Inhibitory receptor (P58-CL42) for human natural killer cells. Determined by X-ray diffraction at 1.7 Å resolution. Released 11 Nov 1998.
Explore 1NKR in 3D Show helices and sheets RCSB PDB PDBe
1NKR contains 5 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-13 | 5 | 1 |
| β-strand | 17-19 | 3 | 2 |
| β-strand | 24-30 | 7 | 1 |
| β-strand | 36-42 | 7 | 3 |
| β-strand | 47-52 | 6 | 3 |
| α-helix | 53 | 1 | |
| β-strand | 54-56 | 3 | 1 |
| β-strand | 59-66 | 8 | 1 |
| α-helix | 71-73 | 3 | |
| β-strand | 75-82 | 8 | 3 |
| β-strand | 83 | 1 | 4 |
| β-strand | 86 | 1 | 4 |
| α-helix | 91-96 | 6 | |
| β-strand | 97-99 | 3 | 3 |
| β-strand | 100-102 | 3 | 2 |
| β-strand | 109-113 | 5 | 5 |
| β-strand | 117-118 | 2 | 6 |
| β-strand | 123-130 | 8 | 5 |
| β-strand | 136-141 | 6 | 7 |
| β-strand | 148-151 | 4 | 7 |
| α-helix | 152 | 1 | |
| β-strand | 153-156 | 4 | 5 |
| β-strand | 159-168 | 10 | 5 |
| β-strand | 173-181 | 9 | 7 |
| β-strand | 184-188 | 5 | 7 |
| α-helix | 190-194 | 5 | |
| β-strand | 195-197 | 3 | 7 |
| β-strand | 198-199 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| P58-CL42 kir | A | protein | 201 | Homo sapiens | P43626 (AlphaFold model) |
>1NKR_1 P58-CL42 KIR (chains A) MHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGV SKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVL AGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFG SFHDSPYEWSKSSDPLLVSVT
Structure of the inhibitory receptor for human natural killer cells resembles haematopoietic receptors. Fan, Q.R., Mosyak, L., Winter, C.C. et al. Nature (1997) 389:96-100. DOI 10.1038/38028 · PubMed
Other PDB entries of the same protein (UniProt P43626 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1NKR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.