Murine inducible nitric oxide synthase oxygenase domain (delta 114), imidazole complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 14 Oct 1998.
Explore 1NOS in 3D Show helices and sheets RCSB PDB PDBe
1NOS contains 18 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 116-118 | 3 | |
| β-strand | 120 | 1 | 1 |
| α-helix | 127-129 | 3 | |
| α-helix | 130-146 | 17 | |
| α-helix | 153-170 | 18 | |
| α-helix | 177-189 | 13 | |
| α-helix | 196-199 | 4 | |
| β-strand | 204-207 | 4 | 2 |
| α-helix | 214-229 | 16 | |
| α-helix | 230-232 | 3 | |
| β-strand | 237-240 | 4 | 2 |
| α-helix | 242-244 | 3 | |
| β-strand | 252-253 | 2 | 3 |
| β-strand | 257 | 1 | 2 |
| β-strand | 261 | 1 | 4 |
| β-strand | 263-265 | 3 | 5 |
| β-strand | 271-273 | 3 | 5 |
| α-helix | 275-277 | 3 | |
| α-helix | 278-286 | 9 | |
| β-strand | 298 | 1 | 4 |
| α-helix | 299-300 | 2 | |
| β-strand | 301-304 | 4 | 3 |
| α-helix | 308-310 | 3 | |
| β-strand | 311-313 | 3 | 3 |
| α-helix | 314-316 | 3 | |
| α-helix | 317-319 | 3 | |
| β-strand | 322-324 | 3 | 6 |
| β-strand | 339-341 | 3 | 6 |
| β-strand | 345-346 | 2 | 2 |
| β-strand | 350-353 | 4 | 7 |
| β-strand | 356-358 | 3 | 7 |
| β-strand | 363-364 | 2 | 2 |
| β-strand | 367 | 1 | 8 |
| α-helix | 414-422 | 9 | |
| β-strand | 427 | 1 | 8 |
| α-helix | 430-444 | 15 | |
| β-strand | 482-484 | 3 | 7 |
| β-strand | 485 | 1 | 1 |
| α-helix | 489-491 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Inducible nitric oxide synthase | A | protein | 388 | Mus musculus | P29477 (AlphaFold model) |
>1NOS_1 INDUCIBLE NITRIC OXIDE SYNTHASE (chains A) NPKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAVTKEIETTGTYQ LTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHICRHILYATNNGNI RSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFTQLCIDLGWKPRYG RFDVLPLVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVG GLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINV AVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGSITPVFHQEM LNYVLSPFYYYQIEPWKTHIWQNEHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
Water and common crystallization additives (IMD) are not listed.
The structure of nitric oxide synthase oxygenase domain and inhibitor complexes. Crane, B.R., Arvai, A.S., Gachhui, R. et al. Science (1997) 278:425-431. DOI 10.1126/science.278.5337.425 · PubMed
Other PDB entries of the same protein (UniProt P29477 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1NOS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.