1NRE: Receptor-associated protein

Receptor associated protein (RAP) domain 1, NMR, minimized average structure. Determined by solution NMR. Released 20 Aug 1997.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 671
Mol. weight: 9.54 kDa
Released: 20 Aug 1997

Explore 1NRE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NRE contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	23-34	12
α-helix	39-65	27
α-helix	73-88	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-associated protein	A	protein	81	Homo sapiens	P30533 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NRE_1 RECEPTOR-ASSOCIATED PROTEIN (chains A)
GEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEAR
LIRNLNVILAKYGLDGKKDAR

Primary citation

The solution structure of the N-terminal domain of alpha2-macroglobulin receptor-associated protein. Nielsen, P.R., Ellgaard, L., Etzerodt, M. et al. Proc Natl Acad Sci U S A (1997) 94:7521-7525. DOI 10.1073/pnas.94.14.7521 · PubMed

Other PDB entries of the same protein (UniProt P30533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FCW 1.26 Å, Structure of a Complex Between the Pair of the LDL Receptor Ligand-Binding Modules 3-4…
9QAW 3.34 Å, CryoEM structure of the human LRP2 receptor ectodomain in complex with LRPAP1
1LRE Receptor associated protein (RAP) domain 1, NMR, 20 structures
1OP1 Solution NMR structure of domain 1 of receptor associated protein
1OV2 Ensemble of the solution structures of domain one of receptor associated protein
2FTU solution structure of domain 3 of RAP
2FYL Haddock model of the complex between double module of LRP, CR56, and first domain of…
2P01 The structure of receptor-associated protein(RAP)
2P03 The structure of receptor-associated protein(RAP)

Browse structure collections

About this viewer

MolViewer shows 1NRE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.