2FTU: Domain 3 of RAP

solution structure of domain 3 of RAP. Determined by solution NMR. Released 9 May 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 978
Mol. weight: 13.88 kDa
Released: 9 May 2006

Explore 2FTU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FTU contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	18-24	7
α-helix	32-70	39
α-helix	76-112	37
β-strand	115	1	1
β-strand	117	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-2-macroglobulin receptor-associated protein, domain 3	A	protein	118	Homo sapiens	P30533 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FTU_1 Alpha-2-macroglobulin receptor-associated protein, domain 3 (chains A)
RVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDKELEAFREELKHFEAKIEKHNHYQKQLE
IAHEKLRHAESVGDGERVSRSREKHALLEGRTKELGYTVKKHLQDLSGRISRARHNEL

Primary citation

RAP uses a histidine switch to regulate its interaction with LRP in the ER and Golgi. Lee, D., Walsh, J.D., Mikhailenko, I. et al. Mol Cell (2006) 22:423-430. DOI 10.1016/j.molcel.2006.04.011 · PubMed

Other PDB entries of the same protein (UniProt P30533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FCW 1.26 Å, Structure of a Complex Between the Pair of the LDL Receptor Ligand-Binding Modules 3-4…
9QAW 3.34 Å, CryoEM structure of the human LRP2 receptor ectodomain in complex with LRPAP1
1LRE Receptor associated protein (RAP) domain 1, NMR, 20 structures
1NRE Receptor associated protein (RAP) domain 1, NMR, minimized average structure
1OP1 Solution NMR structure of domain 1 of receptor associated protein
1OV2 Ensemble of the solution structures of domain one of receptor associated protein
2FYL Haddock model of the complex between double module of LRP, CR56, and first domain of…
2P01 The structure of receptor-associated protein(RAP)
2P03 The structure of receptor-associated protein(RAP)

Browse structure collections

About this viewer

MolViewer shows 2FTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.