1NW9: Baculoviral IAP repeat-containing protein 4

Structure of caspase-9 in an inhibitory complex with xiap-BIR3. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Mar 2003.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,590
Mol. weight: 41.87 kDa
Ligands: ZN
Released: 25 Mar 2003

Explore 1NW9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1NW9 contains 15 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	260-262	3
α-helix	265-270	6
α-helix	281-286	6
β-strand	289-291	3	1
β-strand	298-300	3	1
β-strand	306-307	2	1
β-strand	308	1	2
α-helix	316-323	8
α-helix	328-334	7
α-helix	336-343	8

Chain B: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	143-147	5
β-strand	152	1	3
β-strand	161-167	7	4
α-helix	173-175	3
α-helix	177-179	3
α-helix	183-196	14
β-strand	199-205	7	4
α-helix	209-221	13
β-strand	229-237	9	4
β-strand	238-239	2	5
β-strand	249-251	3	5
β-strand	257-259	3	5
α-helix	260-265	6
α-helix	273-275	3
β-strand	280-287	8	4
β-strand	317	1	2
β-strand	341-346	6	4
β-strand	351	1	6
β-strand	361	1	6
α-helix	362-374	13
α-helix	380-392	13
β-strand	404-405	2	4
β-strand	410	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 4	A	protein	98	Homo sapiens	P98170 (AlphaFold model)
caspase 9, apoptosis-related cysteine protease	B	protein	277	Homo sapiens	P55211 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1NW9_1 Baculoviral IAP repeat-containing protein 4 (chains A)
STNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKP
SEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEE

Sequence of entity 2 (B), FASTA

>1NW9_2 caspase 9, apoptosis-related cysteine protease (chains B)
GALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHF
MVEVKGDLTAKKMVLALLELARQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVS
VEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPF
QEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSED
LQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Mechanism of XIAP-Mediated Inhibition of Caspase-9. Shiozaki, E.N., Chai, J., Rigotti, D.J. et al. Mol Cell (2003) 11:519-527. DOI 10.1016/S1097-2765(03)00054-6 · PubMed

Other PDB entries of the same protein (UniProt P98170 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4J44 1.3 Å, Crystal structure of XIAP-BIR2 domain with AIAV bound
8W59 1.34 Å, Crystal structure of the RING domain of human XIAP treated with arsenic trioxide
4J47 1.35 Å, Crystal structure of XIAP-BIR2 domain with SVPI bound
4J46 1.42 Å, Crystal structure of XIAP-BIR2 domain with AVPI bound
4J3Y 1.45 Å, Crystal structure of XIAP-BIR2 domain
4J45 1.48 Å, Crystal structure of XIAP-BIR2 domain with ATAA bound
5O6T 1.57 Å, BIRC4 RING in complex with dimeric ubiquitin variant
4KJU 1.6 Å, Crystal structure of XIAP-Bir2 with a bound benzodiazepinone inhibitor.
8W5A 1.65 Å, Crystal structure of the RING domain of human XIAP
4KJV 1.7 Å, Crystal structure of XIAP-Bir2 with a bound spirocyclic benzoxazepinone inhibitor.
3UW5 1.71 Å, Crystal structure of the BIR domain of MLIAP bound to GDC0152
8GH7 1.75 Å, 142D6 bound to BIR3-XIAP

Browse structure collections

About this viewer

MolViewer shows 1NW9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.