1O0L: Apoptosis regulator Bcl-W

Name: PDB 1O0L: The structure of bcl-W reveals a role for the C-terminal residues in modulating biological activity
Published: 2003-04-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

The structure of bcl-W reveals a role for the C-terminal residues in modulating biological activity. Determined by solution NMR. Released 1 Apr 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,428
Mol. weight: 20.25 kDa
Released: 1 Apr 2003

Explore 1O0L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O0L contains 11 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	10-24	15
α-helix	33-35	3
α-helix	43-56	14
α-helix	61-67	7
α-helix	76-86	11
α-helix	93-111	19
α-helix	116-129	14
α-helix	130-134	5
α-helix	135-141	7
α-helix	144-150	7
α-helix	157-170	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apoptosis regulator Bcl-W	A	protein	188	Homo sapiens	Q92843 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1O0L_1 Apoptosis regulator Bcl-W (chains A)
GPLGSMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFET
RFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEM
EPLVGQVQEWMVEYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLT
GAVALGAL

Primary citation

The structure of Bcl-w reveals a role for the C-terminal residues in modulating biological activity. Hinds, M.G., Lackmann, M., Skea, G.L. et al. EMBO J (2003) 22:1497-1507. DOI 10.1093/emboj/cdg144 · PubMed

Other PDB entries of the same protein (UniProt Q92843 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CIM 1.5 Å, Complex of a Bcl-w BH3 mutant with a BH3 domain
2Y6W 2.0 Å, Structure of a Bcl-w dimer
1MK3 Solution structure of human bcl-W protein
1ZY3 Structural model of complex of Bcl-w protein with Bid BH3-peptide

Browse structure collections

About this viewer

MolViewer shows 1O0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.