1O0P: Third RNA Recognition Motif (RRM) of U2AF65

Solution Structure of the third RNA Recognition Motif (RRM) of U2AF65 in complex with an N-terminal SF1 peptide. Determined by solution NMR. Released 6 May 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 956
Mol. weight: 13.67 kDa
Released: 6 May 2003

Explore 1O0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O0P contains 5 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	377-381	5	1
α-helix	392-406	15
β-strand	412-416	5	1
β-strand	431-436	6	1
α-helix	439-449	11
α-helix	458-459	2
β-strand	460-464	5	1
α-helix	465	1
α-helix	466-471	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor U2AF 65 kDa subunit	A	protein	104	Homo sapiens	P26368 (AlphaFold model)
Splicing Factor SF1	B	protein	13		Q15637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1O0P_1 Splicing factor U2AF 65 kDa subunit (chains A)
GHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGK
IFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW

Sequence of entity 2 (B), FASTA

>1O0P_2 Splicing Factor SF1 (chains B)
PSKKRKRSRWNQD

Primary citation

Structural Basis for the molecular recognition between human splicing factors U2AF65 and SF1/mBBP. Selenko, P., Gregorovic, G., Sprangers, R. et al. Mol Cell (2003) 11:965-976. DOI 10.1016/S1097-2765(03)00115-1 · PubMed

Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0G 1.07 Å, Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
5W0H 1.11 Å, Structure of U2AF65 (U2AF2) RRM2 at 1.11 Angstrom Resolution
6XLV 1.4 Å, Crystal structure of leukemia-associated N196K mutant of U2AF65 bound to AdML splice site
9C7A 1.4 Å, Crystal structure of R149W neurodevelopmental disease-associated U2AF2 variant
9C7B 1.4 Å, Crystal structure of R150H neurodevelopmental disease-associated U2AF2 variant
2HZC 1.47 Å, Crystal structure of the N-terminal RRM of the U2AF large subunit
7S3A 1.48 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-C5 oligonucleotide
5EV3 1.5 Å, Structure III of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLW 1.5 Å, Crystal structure of U2AF65 bound to AdML splice site sequence
7S3C 1.51 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-A5 oligonucleotide
5EV4 1.57 Å, Structure IV of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLX 1.7 Å, Crystal structure of cancer-associated G301D mutant of U2AF65 bound to AdML splice site

Browse structure collections

About this viewer

MolViewer shows 1O0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.