5W0H: U2AF65 (U2AF2) RRM2

Structure of U2AF65 (U2AF2) RRM2 at 1.11 Angstrom Resolution. Determined by X-ray diffraction at 1.11 Å resolution. Released 11 Apr 2018.

Method: X-ray diffraction
Resolution: 1.11 Å
Organism: Homo sapiens
Chains: 1
Atoms: 855
Mol. weight: 8.97 kDa
Released: 11 Apr 2018

Explore 5W0H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W0H contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	260-264	5	1
α-helix	272-280	9
β-strand	285-292	8	1
β-strand	299-307	9	1
α-helix	310-320	11
β-strand	324-325	2	2
β-strand	328-329	2	2
β-strand	331-334	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Splicing factor U2AF 65 kDa subunit	A	protein	84	Homo sapiens	P26368 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5W0H_1 Splicing factor U2AF 65 kDa subunit (chains A)
GPLGSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINV
TDQAIAGLNGMQLGDKKLLVQRAS

Primary citation

Cancer-Associated Mutations Mapped on High-Resolution Structures of the U2AF2 RNA Recognition Motifs. Glasser, E., Agrawal, A.A., Jenkins, J.L. et al. Biochemistry (2017) 56:4757-4761. DOI 10.1021/acs.biochem.7b00551 · PubMed

Other PDB entries of the same protein (UniProt P26368 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0G 1.07 Å, Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
6XLV 1.4 Å, Crystal structure of leukemia-associated N196K mutant of U2AF65 bound to AdML splice site
9C7A 1.4 Å, Crystal structure of R149W neurodevelopmental disease-associated U2AF2 variant
9C7B 1.4 Å, Crystal structure of R150H neurodevelopmental disease-associated U2AF2 variant
2HZC 1.47 Å, Crystal structure of the N-terminal RRM of the U2AF large subunit
7S3A 1.48 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-C5 oligonucleotide
5EV3 1.5 Å, Structure III of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLW 1.5 Å, Crystal structure of U2AF65 bound to AdML splice site sequence
7S3C 1.51 Å, Crystal structure of intact U2AF65 RRM-region bound to AdML-A5 oligonucleotide
5EV4 1.57 Å, Structure IV of Intact U2AF65 Recognizing the 3' Splice Site Signal
6XLX 1.7 Å, Crystal structure of cancer-associated G301D mutant of U2AF65 bound to AdML splice site
7SN6 1.8 Å, U2AF65 uhm bound to SF3B155 ULM5

Browse structure collections

About this viewer

MolViewer shows 5W0H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.