1O0V: Immunoglobulin heavy chain epsilon-1

The crystal structure of IgE Fc reveals an asymmetrically bent conformation. Determined by X-ray diffraction at 2.6 Å resolution. Released 18 Sept 2002.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,436
Mol. weight: 75.72 kDa
Released: 18 Sept 2002

Explore 1O0V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O0V contains 34 α-helices and 55 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	233-239	7	1
α-helix	240-241	2
α-helix	246-248	3
β-strand	250-259	11	1
β-strand	264-270	7	2
β-strand	273-274	2	2
α-helix	275-276	2
α-helix	277-279	3
β-strand	280-287	8	1
β-strand	290-300	11	1
α-helix	301-305	5
β-strand	310-316	7	2
β-strand	319-325	7	2
α-helix	328-330	3
α-helix	333-335	3
β-strand	337-340	4	3
α-helix	342-344	3
α-helix	345	1
α-helix	346-351	6
β-strand	355-363	9	3
α-helix	369-370	2
β-strand	371-376	6	4
β-strand	397-404	8	3
α-helix	407-411	5
β-strand	415-421	7	4
β-strand	428-434	7	4
β-strand	441	1	5
α-helix	442-443	2
β-strand	444-449	6	6
α-helix	450-452	3
β-strand	453	1	7
β-strand	456	1	7
β-strand	459-469	11	6
β-strand	470	1	5
β-strand	475-480	6	8
β-strand	483-484	2	8
α-helix	485-486	2
α-helix	487-489	3
β-strand	490-492	3	6
α-helix	493-495	3
β-strand	496-497	2	6
β-strand	503-512	10	6
α-helix	513-518	6
β-strand	522-527	6	8
β-strand	536-541	6	8

Chain B: 16 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	230-232	3
β-strand	233-239	7	1
α-helix	240-241	2
α-helix	246-248	3
β-strand	250-257	9	1
β-strand	267-270	4	9
β-strand	273-275	3	9
α-helix	276	1
α-helix	277-279	3
β-strand	282-284	3	1
β-strand	292-300	9	1
α-helix	301-305	5
β-strand	310-315	6	9
β-strand	320-325	6	9
α-helix	327-330	4
β-strand	337-340	4	10
α-helix	345-346	2
α-helix	347-351	5
β-strand	355-363	9	10
β-strand	371-376	6	11
β-strand	386-391	6	10
β-strand	397-404	8	10
α-helix	407-411	5
β-strand	416-421	6	11
α-helix	428	1
β-strand	429-433	5	11
β-strand	441	1	12
α-helix	442-443	2
β-strand	444-449	6	13
α-helix	450-452	3
β-strand	453	1	14
β-strand	456	1	14
β-strand	459-469	11	13
β-strand	470	1	12
β-strand	475-480	6	15
β-strand	483-484	2	15
α-helix	487-489	3
β-strand	490-492	3	13
α-helix	493-495	3
β-strand	496-497	2	13
β-strand	503-512	10	13
α-helix	513-518	6
β-strand	522-527	6	15
β-strand	536-541	6	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin heavy chain epsilon-1	A, B	protein	327	Homo sapiens	P01854 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1O0V_1 Immunoglobulin heavy chain epsilon-1 (chains A, B)
DIVASRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTIQITWLEDGQVMDVDLS
TASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYL
SRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVNHSTRKEEKQRNGTLTVT
STLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKR
TLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKD
EFICRAVHEAASPSQTVQRAVSVNPGL

Primary citation

The crystal structure of IgE Fc reveals an asymmetrically bent conformation. Wan, T., Beavil, R.L., Fabiane, S.M. et al. Nat Immunol (2002) 3:681-686. DOI 10.1038/ni811 · PubMed

Other PDB entries of the same protein (UniProt P01854 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MOL 1.75 Å, Human IgE-Fc crystal structure
2WQR 1.9 Å, The high resolution crystal structure of IgE Fc
5MOK 2.0 Å, Crystal structure of human IgE-Fc epsilon 3-4
5MOI 2.2 Å, Crystal structure of human IgE-Fc epsilon 3-4
3H9Y 2.23 Å, Crystal structure of the IgE-Fc3-4 domains
5MOJ 2.26 Å, Crystal structure of IgE-Fc epsilon 3-4
1FP5 2.3 Å, Crystal structure analysis of the human IgE-fc CEPSILON3-CEPSILON4 fragment.
30AF 2.4 Å, Complex between IgE-Fc and anti-IgE Fab aeFab98
3H9Z 2.45 Å, Crystal structure of the IgE-Fc3-4 domains
5HYS 2.5 Å, Structure of IgE complexed with omalizumab
5LGJ 2.6 Å, The crystal structure of IgE fc mutant - P333C
4GT7 2.61 Å, An engineered disulfide bond reversibly traps the IgE-Fc3-4 in a closed, non-receptor…

Browse structure collections

About this viewer

MolViewer shows 1O0V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.