Crystal structure of mouse ARF1 (delta17-Q71L), GTP form. Determined by X-ray diffraction at 1.5 Å resolution. Released 20 May 2003.
Explore 1O3Y in 3D Show helices and sheets RCSB PDB PDBe
1O3Y contains 16 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-23 | 6 | 1 |
| α-helix | 30-39 | 10 | |
| β-strand | 51-58 | 8 | 1 |
| β-strand | 61-68 | 8 | 1 |
| α-helix | 72-81 | 10 | |
| β-strand | 87-93 | 7 | 1 |
| α-helix | 97-99 | 3 | |
| α-helix | 100-111 | 12 | |
| α-helix | 114-116 | 3 | |
| β-strand | 120-126 | 7 | 1 |
| α-helix | 136-143 | 8 | |
| α-helix | 145-147 | 3 | |
| β-strand | 153-157 | 5 | 1 |
| β-strand | 159 | 1 | 2 |
| β-strand | 164 | 1 | 2 |
| α-helix | 166-177 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-23 | 6 | 3 |
| α-helix | 30-39 | 10 | |
| β-strand | 51-58 | 8 | 3 |
| β-strand | 61-68 | 8 | 3 |
| α-helix | 75-81 | 7 | |
| β-strand | 87-93 | 7 | 3 |
| α-helix | 97-99 | 3 | |
| α-helix | 100-111 | 12 | |
| α-helix | 114-116 | 3 | |
| β-strand | 120-126 | 7 | 3 |
| α-helix | 136-143 | 8 | |
| α-helix | 145-147 | 3 | |
| β-strand | 153-157 | 5 | 3 |
| β-strand | 159 | 1 | 4 |
| β-strand | 164 | 1 | 4 |
| α-helix | 166-177 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ADP-ribosylation factor 1 | A, B | protein | 166 | Mus musculus | P84078 (AlphaFold model) |
>1O3Y_1 ADP-ribosylation factor 1 (chains A, B) GSMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGLDKIR PLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMN AAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport. Shiba, T., Kawasaki, M., Takatsu, H. et al. Nat Struct Biol (2003) 10:386-393. DOI 10.1038/nsb920 · PubMed
Other PDB entries of the same protein (UniProt P84078 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1O3Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.