Structure of activated form of PKB kinase domain S474D with GSK3 peptide and AMP-PNP. Determined by X-ray diffraction at 1.7 Å resolution. Released 19 Nov 2002.
Explore 1O6K in 3D Show helices and sheets RCSB PDB PDBe
1O6K contains 19 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 149-151 | 3 | |
| β-strand | 152-160 | 9 | 1 |
| β-strand | 164-171 | 8 | 1 |
| β-strand | 177-184 | 8 | 1 |
| α-helix | 185-190 | 6 | |
| α-helix | 194-206 | 13 | |
| β-strand | 212 | 1 | 2 |
| α-helix | 213-214 | 2 | |
| β-strand | 215-220 | 6 | 1 |
| β-strand | 224-230 | 7 | 1 |
| α-helix | 231 | 1 | |
| β-strand | 236 | 1 | 2 |
| α-helix | 237-244 | 8 | |
| α-helix | 249-268 | 20 | |
| β-strand | 272 | 1 | 3 |
| α-helix | 278-280 | 3 | |
| β-strand | 281-283 | 3 | 2 |
| β-strand | 289-291 | 3 | 2 |
| β-strand | 298 | 1 | 3 |
| β-strand | 307 | 1 | 4 |
| β-strand | 311-312 | 2 | 5 |
| α-helix | 314-316 | 3 | |
| β-strand | 327 | 1 | 4 |
| α-helix | 331-345 | 15 | |
| α-helix | 355-364 | 10 | |
| α-helix | 365-367 | 3 | |
| α-helix | 375-384 | 10 | |
| α-helix | 400-404 | 5 | |
| α-helix | 407-409 | 3 | |
| α-helix | 414-418 | 5 | |
| α-helix | 423-424 | 2 | |
| α-helix | 441-444 | 4 | |
| α-helix | 469-470 | 2 | |
| β-strand | 475-476 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-11 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rac-beta serine/threonine protein kinase | A | protein | 336 | HOMO SAPIENS | P31751 (AlphaFold model) |
| Glycogen synthase kinase-3 beta | C | protein | 10 | HOMO SAPIENS | P49841 (AlphaFold model) |
>1O6K_1 RAC-BETA SERINE/THREONINE PROTEIN KINASE (chains A) KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQ NTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEY LHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDN DYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLL KKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTA QSITITPPDRYDSLGLLELDQRTHFPQFDYSASIRE
>1O6K_2 GLYCOGEN SYNTHASE KINASE-3 BETA (chains C) GRPRTTSFAE
| ID | Name | Formula | Copies |
|---|---|---|---|
| MN | Manganese (II) ion | Mn | 2 |
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
Crystal Structure of an Activated Akt/Protein Kinase B Ternary Complex with Gsk-3 Peptide and AMP-Pnp. Yang, J., Cron, P., Good, V.M. et al. Nat Struct Biol (2002) 9:940. DOI 10.1038/NSB870 · PubMed
Other PDB entries of the same protein (UniProt P31751 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1O6K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.