1O7Z: IP-10 T-form

Name: PDB 1O7Z: Crystal structure of IP-10 T-form
Published: 2003-05-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chemokine

Crystal structure of IP-10 T-form. Determined by X-ray diffraction at 1.92 Å resolution. Released 8 May 2003.

Method: X-ray diffraction
Resolution: 1.92 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 930
Mol. weight: 17.27 kDa
Released: 8 May 2003

Explore 1O7Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O7Z contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	18-19	2
β-strand	24-30	7	1
β-strand	40-45	6	1
β-strand	51-54	4	1
α-helix	59-67	9

Chain B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
α-helix	18-19	2
β-strand	24-30	7	1
β-strand	40-45	6	1
β-strand	51-54	4	1
α-helix	59-62	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Small inducible cytokine B10	A, B	protein	77	HOMO SAPIENS	P02778 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1O7Z_1 SMALL INDUCIBLE CYTOKINE B10 (chains A, B)
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA
IKNLLKAVSKEMSKRSP

Primary citation

Crystal Structures of Oligomeric Forms of the Ip-10/Cxcl10 Chemokine. Swaminathan, G.J., Holloway, D.E., Colvin, R.A. et al. Structure (2003) 11:521. DOI 10.1016/S0969-2126(03)00070-4 · PubMed

Other PDB entries of the same protein (UniProt P02778 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1O80 2.0 Å, Crystal structure of IP-10 H-Form
1O7Y 3.0 Å, Crystal structure of IP-10 M-form
9P0L 3.1 Å, Composite map of CXCL10-CXCR3-Gi-scFv16
8K2X 3.2 Å, CXCR3-DNGi complex activated by CXCL10
1LV9 CXCR3 Binding Chemokine IP-10/CXCL10

Browse structure collections

About this viewer

MolViewer shows 1O7Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.