1O9U: Glycogen synthase kinase 3 beta

Glycogen synthase kinase 3 beta complexed with axin peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 15 Aug 2003.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,086
Mol. weight: 41.91 kDa
Ligands: ADZ
Released: 15 Aug 2003

Explore 1O9U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1O9U contains 25 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	38-44	7	1
β-strand	52-64	13	1
β-strand	68-75	8	1
β-strand	81-89	9	1
α-helix	96-101	6
β-strand	109	1	2
β-strand	112-118	7	1
β-strand	126-133	8	1
β-strand	137-138	2	2
α-helix	139-148	10
α-helix	155-174	20
β-strand	177-178	2	3
α-helix	184-186	3
β-strand	187-189	3	2
β-strand	196-198	3	2
β-strand	205-206	2	3
α-helix	220-222	3
α-helix	225-228	4
α-helix	237-252	16
α-helix	262-273	12
α-helix	276-277	2
α-helix	278-284	7
α-helix	286-288	3
α-helix	296-299	4
α-helix	301-304	4
α-helix	311-318	8
α-helix	325-327	3
α-helix	329-330	2
α-helix	331-336	6
α-helix	338-344	7
β-strand	349	1	4
α-helix	354	1
β-strand	355	1	4
α-helix	356-357	2
α-helix	364-367	4
α-helix	371-373	3
α-helix	374-377	4
α-helix	380-383	4

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	384-399	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogen synthase kinase-3 beta	A	protein	350	HOMO SAPIENS	P49841 (AlphaFold model)
Axin peptide	B	protein	18	HOMO SAPIENS	O15169 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1O9U_1 GLYCOGEN SYNTHASE KINASE-3 BETA (chains A)
SKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQGKAFK
NRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPATVYRVARHYSRAKQTLP
VIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNV
SYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLG
TPTREQIREMNPNYTEFAFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEA
CAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARI

Sequence of entity 2 (B), FASTA

>1O9U_2 AXIN PEPTIDE (chains B)
VEPQKFAEELIHRLEAVQ

Ligands and cofactors

ID	Name	Formula	Copies
ADZ	9-methyl-9H-purin-6-amine	C6 H7 N5	1

Primary citation

Structural Basis for Recruitment of Glycogen Synthase Kinase 3Beta to the Axin-Apc Scaffold Complex. Dajani, R., Fraser, E., Roe, S.M. et al. EMBO J (2003) 22:494. DOI 10.1093/EMBOJ/CDG068 · PubMed

Other PDB entries of the same protein (UniProt P49841 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9X2V 1.39 Å, GSK3beta complexed with BiS-3
1O6L 1.6 Å, Crystal structure of an activated Akt/protein kinase B (PKB-PIF chimera) ternary complex…
9X2Q 1.68 Å, GSK3beta complexed with BiS-1
1O6K 1.7 Å, Structure of activated form of PKB kinase domain S474D with GSK3 peptide and AMP-PNP
9X2X 1.79 Å, GSK3beta complexed with BiS-5
1J1B 1.8 Å, Binary complex structure of human tau protein kinase I with AMPPNP
2JDO 1.8 Å, Structure of pkb-beta (AKT2) complexed with isoquinoline-5-sulfonic acid…
7SXJ 1.85 Å, BIO-2895 (BRD0705) bound GSK3beta-axin complex
3QKL 1.9 Å, Spirochromane Akt Inhibitors
9X2W 1.92 Å, GSK3beta complexed with BiS-4
2X39 1.93 Å, Structure of 4-Amino-N-(4-chlorobenzyl)-1-(7H-pyrrolo(2,3-d)pyrimidin-…
1Q5K 1.94 Å, crystal structure of Glycogen synthase kinase 3 in complexed with inhibitor

Browse structure collections

About this viewer

MolViewer shows 1O9U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.