1OCW: Free conformation Ab2 of the IgE SPE-7

Free conformation Ab2 of the IgE SPE-7. Determined by X-ray diffraction at 2.0 Å resolution. Released 5 Feb 2004.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: MUS MUSCULUS
Chains: 2
Atoms: 1,835
Mol. weight: 26.2 kDa
Released: 5 Feb 2004

Explore 1OCW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OCW contains 2 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9-12	4	2
β-strand	18-24	7	1
β-strand	35-39	5	2
β-strand	46	1	2
β-strand	70-73	4	1
β-strand	78-83	6	1
β-strand	92-98	7	2
β-strand	109-110	2	2
β-strand	114-118	5	2

Chain L: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	3
β-strand	9-12	4	2
β-strand	18-24	7	3
α-helix	31-33	3
β-strand	36-41	6	2
β-strand	45-51	7	2
β-strand	55-56	2	2
α-helix	57	1
β-strand	64-69	6	3
β-strand	72-77	6	3
β-strand	86-93	8	2
β-strand	98-100	3	2
β-strand	104-108	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin E	H	protein	121	MUS MUSCULUS
Immunoglobulin E	L	protein	120	MUS MUSCULUS	P01724 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>1OCW_1 IMMUNOGLOBULIN E (chains H)
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKY
NEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSS
A

Sequence of entity 2 (L), FASTA

>1OCW_2 IMMUNOGLOBULIN E (chains L)
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGV
PARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVLEQPKSSPSVTL

Primary citation

Antibody Multispecificity Mediated by Conformational Diversity. James, L.C., Roversi, P., Tawfik, D. Science (2003) 299:1362. DOI 10.1126/SCIENCE.1079731 · PubMed

Other PDB entries of the same protein (UniProt P01724 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OAQ 1.5 Å, Free conformation Ab1 of the IgE SPE-7
1A6V 1.8 Å, B1-8 FV fragment complexed with a (4-hydroxy-3-nitrophenyl) acetate compound
1OAU 1.8 Å, Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)
1A6W 2.0 Å, B1-8 fv fragment complexed with a (4-hydroxy-5-iodo-3-nitrophenyl) acetate compound
1Q0Y 2.0 Å, Anti-Morphine Antibody 9B1 Complexed with Morphine
1A6U 2.1 Å, B1-8 fv fragment
2BJM 2.15 Å, SPE7:Anthrone Complex
1OAR 2.23 Å, Fv IgE SPE-7 in complex with Alizarin Red
1DL7 2.35 Å, The structural basis of repertoire shift in an immune response to phosphocholine
1OAY 2.66 Å, Antibody multispecificity mediated by conformational diversity
1OAX 2.67 Å, Fv Structure of the IgE SPE-7 in complex with acenaphthenequinone
1OAZ 2.78 Å, IgE Fv SPE7 complexed with a recombinant thioredoxin

Browse structure collections

About this viewer

MolViewer shows 1OCW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.