1OAZ: IgE Fv SPE7

IgE Fv SPE7 complexed with a recombinant thioredoxin. Determined by X-ray diffraction at 2.78 Å resolution. Released 15 Jan 2004.

Method: X-ray diffraction
Resolution: 2.78 Å
Organisms: ESCHERICHIA COLI, MUS MUSCULUS
Chains: 6
Atoms: 5,639
Mol. weight: 77.37 kDa
Released: 15 Jan 2004

Explore 1OAZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OAZ contains 19 α-helices and 67 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	5-6	2	1
α-helix	12	1
α-helix	13-17	5
β-strand	22-28	7	1
β-strand	35	1	2
α-helix	53-56	4
β-strand	68-73	6	1
α-helix	81-84	4
β-strand	88	1	2
β-strand	91-96	6	1
β-strand	100-105	6	1
α-helix	110-117	8

Chain H: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	5
β-strand	10-12	3	6
β-strand	18-25	8	5
α-helix	29-31	3
β-strand	33-39	7	7
β-strand	46-52	7	7
β-strand	57-60	4	7
α-helix	62-64	3
β-strand	72-73	2	5
β-strand	78-83	6	5
α-helix	88-90	3
β-strand	93-100	8	7
β-strand	106-107	2	7
β-strand	109	1	8
β-strand	114-115	2	7
β-strand	116-118	3	6

Chain J: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	9
β-strand	10-12	3	10
β-strand	18-25	8	9
α-helix	29-31	3
β-strand	33-34	2	11
β-strand	36-39	4	12
β-strand	46-52	7	12
β-strand	57-60	4	12
α-helix	62-64	3
β-strand	70-73	4	9
β-strand	78-83	6	9
α-helix	88-90	3
β-strand	93-95	3	12
β-strand	97-100	4	11
β-strand	106-108	3	11
β-strand	109	1	13
β-strand	110	1	11
β-strand	114-115	2	12
β-strand	116-118	3	10

Chain L: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	14
β-strand	9-12	4	8
β-strand	17-22	6	15
β-strand	23-24	2	14
β-strand	36-41	6	8
β-strand	45-51	7	8
β-strand	55-56	2	8
α-helix	57	1
β-strand	64-69	6	15
β-strand	72-78	7	15
β-strand	87-94	8	8
β-strand	97-100	4	8
β-strand	105-108	4	8

Chain N: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	16
β-strand	9-12	4	13
β-strand	17-22	6	17
β-strand	23-24	2	16
β-strand	36-41	6	13
β-strand	45-51	7	13
β-strand	55-56	2	13
α-helix	57	1
β-strand	64-69	6	17
β-strand	72-78	7	17
α-helix	82-84	3
β-strand	87-94	8	13
β-strand	97-100	4	13
β-strand	105-108	4	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin 1	A, B	protein	123	ESCHERICHIA COLI	P0AA25 (AlphaFold model)
Immunoglobulin E	H, J	protein	122	MUS MUSCULUS
Immunoglobulin E	L, N	protein	110	MUS MUSCULUS	P01724 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1OAZ_1 THIOREDOXIN 1 (chains A, B)
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPIEESDDRRYDLVGPCKMIAPILDEI
ADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDA
NLA

Sequence of entity 2 (H, J), FASTA

>1OAZ_2 IMMUNOGLOBULIN E (chains H, J)
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKY
NEKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSS
AA

Sequence of entity 3 (L, N), FASTA

>1OAZ_3 IMMUNOGLOBULIN E (chains L, N)
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGV
PARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVLT

Primary citation

Antibody Multispecificity Mediated by Conformational Diversity. James, L.C., Roversi, P., Tawfik, D. Science (2003) 299:1362. DOI 10.1126/SCIENCE.1079731 · PubMed

Other PDB entries of the same protein (UniProt P0AA25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HUA 1.1 Å, E. coli thioredoxin variant with (4R)-FluoroPro76 as single proline residue
5HR3 1.1 Å, Crystal structure of thioredoxin N106A mutant
5HR2 1.2 Å, Crystal structure of thioredoxin L94A mutant
5HR0 1.31 Å, Crystal structure of thioredoxin E101G mutant
4HU7 1.4 Å, E. coli thioredoxin variant with Pro76 as single proline residue
4HU9 1.55 Å, E. coli thioredoxin variant with (4S)-FluoroPro76 as single proline residue
4X43 1.65 Å, Structure of proline-free E. coli Thioredoxin
2TRX 1.68 Å, Crystal structure of thioredoxin from escherichia coli at 1.68 Å resolution
6Y4Y 1.75 Å, The crystal structure of human MACROD2 in space group P41212
1KEB 1.8 Å, Crystal Structure of Double Mutant M37L,P40S E.coli Thioredoxin
2EIQ 1.9 Å, Design of Disulfide-linked Thioredoxin Dimers and Multimers Through Analysis of Crystal…
6Y4Z 1.9 Å, The crystal structure of human MACROD2 in space group P43212

Browse structure collections

About this viewer

MolViewer shows 1OAZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.