1OHQ: Immunoglobulin

Name: PDB 1OHQ: Crystal structure of HEL4, a soluble human VH antibody domain resistant to aggregation
Published: 2004-03-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: immunoglobulin

Crystal structure of HEL4, a soluble human VH antibody domain resistant to aggregation. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Mar 2004.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,956
Mol. weight: 25.72 kDa
Released: 11 Mar 2004

Explore 1OHQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OHQ contains 4 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	33-40	8	2
β-strand	44-52	9	2
β-strand	58-60	3	2
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	110	1	2
β-strand	114-118	5	2

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	3
β-strand	10-12	3	4
β-strand	18-25	8	3
β-strand	33-39	7	4
β-strand	45-52	8	4
β-strand	57-60	4	4
α-helix	62-64	3
β-strand	68-73	6	3
β-strand	78-83	6	3
α-helix	88-90	3
β-strand	92-100	9	4
β-strand	107-110	4	4
β-strand	114-118	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin	A, B	protein	120	HOMO SAPIENS	P01764 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1OHQ_1 IMMUNOGLOBULIN (chains A, B)
EVQLLESGGGLVQPGGSLRLSCAASGFRISDEDMGWVRQAPGKGLEWVSSIYGPSGSTYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASALEPLSEPLGFWGQGTLVTVSS

Primary citation

Crystal Structure of Hel4, a Soluble, Refoldable Human V(H) Single Domain with a Germ-Line Scaffold. Jespers, L., Schon, O., James, L.C. et al. J Mol Biol (2004) 337:893. DOI 10.1016/J.JMB.2004.02.013 · PubMed

Other PDB entries of the same protein (UniProt P01764 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZHD 1.96 Å, The crystal structure of single domain antibody 8-4 scaffold.
3ZHK 1.96 Å, The crystal structure of single domain antibody 2x1 scaffold
3ZHL 2.47 Å, The crystal structure of single domain antibody 8-14 scaffold
3UPC 2.8 Å, A general strategy for the generation of human antibody variable domains with increased…
4KFZ 2.8 Å, Crystal structure of LMO2 and anti-LMO2 VH complex
9N7Q 3.18 Å, H1 hemagglutinin (A/Michigan/45/2015) in complex with anchor-targeting Fab ST15

Browse structure collections

About this viewer

MolViewer shows 1OHQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.