1OIV: Small G protein Rab11a

X-ray structure of the small G protein Rab11a in complex with GDP. Determined by X-ray diffraction at 1.98 Å resolution. Released 8 Jan 2004.

Method: X-ray diffraction
Resolution: 1.98 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,932
Mol. weight: 44.12 kDa
Ligands: GDP
Released: 8 Jan 2004

Explore 1OIV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OIV contains 14 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
α-helix	24-33	10
β-strand	46-55	10	1
β-strand	58-67	10	1
α-helix	74-81	8
β-strand	84-92	9	1
α-helix	96-100	5
α-helix	102-112	11
β-strand	118-124	7	1
α-helix	129-131	3
α-helix	136-146	11
β-strand	149-152	4	1
α-helix	161-172	12

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
α-helix	24-33	10
β-strand	46-55	10	1
β-strand	58-67	10	1
α-helix	74-81	8
β-strand	86-92	7	1
α-helix	96-100	5
α-helix	102-112	11
β-strand	118-124	7	1
α-helix	126-131	6
α-helix	136-145	10
β-strand	149-152	4	1
α-helix	161-172	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein rab-11A	A, B	protein	191	HOMO SAPIENS	P62491 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1OIV_1 RAS-RELATED PROTEIN RAB-11A (chains A, B)
MRGSHHHHHHGIPLPGRAMGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKS
TIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENV
ERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVE
AAFQTILTEIY

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2

Water and common crystallization additives (EDO, SO4) are not listed.

Primary citation

The Structural Gdp/GTP Cycle of Rab11 Reveals a Novel Interface Involved in the Dynamics of Recycling Endosomes. Pasqualato, S., Senic-Matuglia, F., Renault, L. et al. J Biol Chem (2004) 279:11480. DOI 10.1074/JBC.M310558200 · PubMed

Other PDB entries of the same protein (UniProt P62491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OIX 1.7 Å, X-ray structure of the small G protein Rab11a in complex with GDP and Pi
2D7C 1.75 Å, Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
2HV8 1.86 Å, Crystal structure of GTP-bound Rab11 in complex with FIP3
1YZK 2.0 Å, GppNHp bound Rab11 GTPase
4C4P 2.0 Å, Crystal Structure of Wild-Type Rab11 Complexed to FIP2
1OIW 2.05 Å, X-ray structure of the small G protein Rab11a in complex with GTPgammaS
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
6IY1 2.11 Å, Structure of human Ras-related protein Rab11
4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
5EZ5 2.4 Å, Crystal structure of active Rab11A (S20V) in complex with GTP
2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2
2GZH 2.47 Å, Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2

Browse structure collections

About this viewer

MolViewer shows 1OIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.