Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein at 1.39 A resolution. Determined by X-ray diffraction at 1.39 Å resolution. Released 6 Apr 2004.
Explore 1OOT in 3D Show helices and sheets RCSB PDB PDBe
1OOT contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 1 |
| β-strand | 10 | 1 | 2 |
| β-strand | 17 | 1 | 1 |
| β-strand | 20 | 1 | 2 |
| β-strand | 25-30 | 6 | 1 |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 46-51 | 6 | 1 |
| α-helix | 52-54 | 3 | |
| β-strand | 55-57 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region | A | protein | 60 | Saccharomyces cerevisiae | P43603 (AlphaFold model) |
>1OOT_1 Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region (chains A) GSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV
Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein at 1.39 A resolution. Kursula, P., Lehmann, F., Song, Y.H. et al. To be published.
Other PDB entries of the same protein (UniProt P43603 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1OOT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.