1OOW: Plastocyanin, chloroplast

The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight into its low reactivity towards photosystem 1 and cytochrome f. Determined by X-ray diffraction at 2.0 Å resolution. Released 17 Feb 2004.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Spinacia oleracea
Chains: 1
Atoms: 779
Mol. weight: 10.56 kDa
Ligands: CU
Released: 17 Feb 2004

Explore 1OOW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OOW contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	14-15	2	1
β-strand	18-21	4	2
α-helix	25	1
β-strand	26-31	6	1
β-strand	37	1	3
β-strand	40-41	2	2
α-helix	43-45	3
α-helix	52-55	4
α-helix	57-58	2
β-strand	63	1	3
β-strand	69-73	5	1
β-strand	78-83	6	2
β-strand	93-98	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plastocyanin, chloroplast	A	protein	99	Spinacia oleracea	P00289 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OOW_1 Plastocyanin, chloroplast (chains A)
VEVLLGGDDGSEAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEE
DLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	1

Primary citation

The crystal structure of the spinach plastocyanin double mutant G8D/L12E gives insight into its low reactivity towards photosystem 1 and cytochrome f. Jansson, H., Okvist, M., Jacobson, F. et al. Biochim Biophys Acta (2003) 1607:203-210. DOI 10.1016/j.bbabio.2003.09.011 · PubMed

Other PDB entries of the same protein (UniProt P00289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AG6 1.6 Å, Plastocyanin from spinach
1TEF 1.9 Å, Crystal structure of the spinach plastocyanin mutants G8D/K30C/T69C and K30C/T69C- a…
1TEG 1.96 Å, Crystal structure of the spinach plastocyanin mutants G8D/K30C/T69C and K30C/T69C- a…
9TGG 3.18 Å, Cryo-EM structure of Spinacia oleracea cytochrome b6f complex with bound plastocyanin
1YLB NMR solution structure of the reduced spinach plastocyanin
2PCF The complex of cytochrome F and plastocyanin determined with paramagnetic NMR. Based on…

Browse structure collections

About this viewer

MolViewer shows 1OOW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.