1OR3: Protein

Apolipoprotein E3 (APOE3), trigonal truncation mutant 165. Determined by X-ray diffraction at 1.73 Å resolution. Released 24 May 2000.

Method: X-ray diffraction
Resolution: 1.73 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,306
Mol. weight: 19.3 kDa
Released: 24 May 2000

Explore 1OR3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OR3 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	25-41	17
α-helix	45-52	8
α-helix	55-81	27
α-helix	92-122	31
α-helix	131-162	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (apolipoprotein E)	A	protein	165	Homo sapiens	P02649 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OR3_1 PROTEIN (APOLIPOPROTEIN E) (chains A)
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQEL
RALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRG
EVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG

Primary citation

Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding. Segelke, B.W., Forstner, M., Knapp, M. et al. Protein Sci (2000) 9:886-897. PubMed

Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FCR 1.4 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
8AX9 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
8AX8 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P3121)
7FCS 1.6 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
1GS9 1.7 Å, Apolipoprotein E4, 22k domain
6NCO 1.71 Å, Fragment-based Discovery of an apoE4 Stabilizer
8CE0 1.75 Å, N-terminal domain of human apolipoprotein E
1NFN 1.8 Å, Apolipoprotein E3 (APOE3)
6NCN 1.82 Å, Fragment-based Discovery of an apoE4 Stabilizer
1BZ4 1.85 Å, Apolipoprotein E3 (apo-E3), truncation mutant 165
9SA6 1.89 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
1H7I 1.9 Å, Apolipoprotein E3 22kD fragment LYS146GLN mutant

Browse structure collections

About this viewer

MolViewer shows 1OR3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.