6NCN: Fragment-based Discovery of an apoE4 Stabilizer

Fragment-based Discovery of an apoE4 Stabilizer. Determined by X-ray diffraction at 1.82 Å resolution. Released 17 Apr 2019.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,329
Mol. weight: 21.73 kDa
Ligands: KJM
Released: 17 Apr 2019

Explore 6NCN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NCN contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	25-42	18
α-helix	45-52	8
α-helix	55-78	24
α-helix	82-84	3
α-helix	87-124	38
α-helix	131-162	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Apolipoprotein E	A	protein	185	Homo sapiens	P02649 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6NCN_1 Apolipoprotein E (chains A)
GSSHHHHHHSSGLVPRGSHMKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWV
QTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAA
QARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLA
VYQAG

Ligands and cofactors

ID	Name	Formula	Copies
KJM	1-(3-chlorophenyl)cyclobutane-1-carboximidamide	C11 H13 Cl N2	1

Primary citation

Fragment-Based Discovery of an Apolipoprotein E4 (apoE4) Stabilizer. Petros, A.M., Korepanova, A., Jakob, C.G. et al. J Med Chem (2019) 62:4120-4130. DOI 10.1021/acs.jmedchem.9b00178 · PubMed

Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FCR 1.4 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
8AX9 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
8AX8 1.55 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P3121)
7FCS 1.6 Å, Crystal structure of the N-terminal domain of mutants of Human Apolipoprotein-E (ApoE)
1GS9 1.7 Å, Apolipoprotein E4, 22k domain
6NCO 1.71 Å, Fragment-based Discovery of an apoE4 Stabilizer
1OR3 1.73 Å, Apolipoprotein E3 (APOE3), trigonal truncation mutant 165
8CE0 1.75 Å, N-terminal domain of human apolipoprotein E
1NFN 1.8 Å, Apolipoprotein E3 (APOE3)
1BZ4 1.85 Å, Apolipoprotein E3 (apo-E3), truncation mutant 165
9SA6 1.89 Å, Human Apolipoprotein E4 (ApoE4) N-terminal domain (space group P212121)
1H7I 1.9 Å, Apolipoprotein E3 22kD fragment LYS146GLN mutant

Browse structure collections

About this viewer

MolViewer shows 6NCN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.