1ORQ: Voltage-dependent potassium channel

X-ray structure of a voltage-dependent potassium channel in complex with an Fab. Determined by X-ray diffraction at 3.2 Å resolution. Released 6 May 2003.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Mus musculus, Aeropyrum pernix
Chains: 3
Atoms: 5,059
Mol. weight: 72.6 kDa
Ligands: CD
Released: 6 May 2003

Explore 1ORQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ORQ contains 20 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	19-20	2	1
β-strand	22-25	4	1
β-strand	29	1	2
α-helix	31-33	3
β-strand	35-39	5	3
β-strand	47-50	4	3
β-strand	54-55	2	3
β-strand	63-68	6	1
β-strand	69	1	2
β-strand	71-76	6	1
α-helix	81-83	3
β-strand	85-91	7	3
β-strand	98-99	2	3
β-strand	104-105	2	3
β-strand	112	1	4
β-strand	115-119	5	5
α-helix	123-128	6
β-strand	131-140	10	5
β-strand	141	1	4
β-strand	145-151	7	6
β-strand	154-156	3	6
β-strand	160-164	5	5
β-strand	174-182	9	5
α-helix	184-187	4
β-strand	192-199	8	6
α-helix	205	1
β-strand	206-211	6	6

Chain B: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	7
β-strand	11-12	2	8
β-strand	18-23	6	9
β-strand	25	1	7
β-strand	34-40	7	10
β-strand	46-53	8	10
β-strand	58-60	3	10
β-strand	68	1	9
β-strand	71-73	3	9
β-strand	78-83	6	9
α-helix	88-90	3
β-strand	92-99	8	10
α-helix	101-103	3
β-strand	105-108	4	10
β-strand	112-114	3	10
β-strand	115-116	2	8
α-helix	120-121	2
β-strand	122	1	11
β-strand	125-129	5	12
β-strand	140-150	11	12
β-strand	151	1	11
β-strand	156-159	4	13
α-helix	160-162	3
β-strand	164	1	13
β-strand	168-170	3	12
α-helix	171-173	3
β-strand	174-175	2	12
β-strand	180-189	10	12
β-strand	199-204	6	13
α-helix	205-207	3
β-strand	209-214	6	13

Chain C: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	25-28	4
α-helix	30-50	21
α-helix	57-78	22
α-helix	83-93	11
α-helix	97-111	15
α-helix	116-132	17
α-helix	137-170	34
α-helix	183-194	12
α-helix	207-238	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
6E1 Fab light chain	A	protein	215	Mus musculus	P01837 (AlphaFold model)
6E1 Fab heavy chain	B	protein	219	Mus musculus	P01865 (AlphaFold model)
potassium channel	C	protein	223	Aeropyrum pernix	Q9YDF8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ORQ_1 6E1 Fab light chain (chains A)
ENVLTQSPAIMSPSPGEKVTMTCRARSSVSSSYLHWYQQKSGASPKLWIYSTSNLASGVP
ARFSGSGSGTSYSLTISSVEAEDTATYYCQQYSGNPWTFGGGTKLEIKRADAAPTVSIFP
PSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTL
TLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B), FASTA

>1ORQ_2 6E1 Fab heavy chain (chains B)
DVQLQESGPGLVKPSQSLSLTCTVTGYSITSLYAWNWIRQFPGNKLEWMGYINYSGYTSY
NPSLKSRISITRDTSKNQFFLQLHSVTTEDTATYSCTRGVDYFAMDYWGQGASVTVSSAK
TTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSDLY
TLSSSVTVTSNTWPSQSITCNVAHPASSTKVDKKIVPRD

Sequence of entity 3 (C), FASTA

>1ORQ_3 potassium channel (chains C)
IGDVMEHPLVELGVSYAALLSVIVVVVECTMQLSGEYLVRLYLVDLILVIILWADYAYRA
YKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKF
LSAIADAADKIRFYHLFGAVMLTVLYGAFAIYIVEYPDPNSSIKSVFDALWWAVVTATTV
GYGDVVPATPIGKVIGIAVMLTGISALTLLIGTVSNMFQKILV

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	7

Water and common crystallization additives (K) are not listed.

Primary citation

X-ray structure of a voltage-dependent K+ channel. Jiang, Y., Lee, A., Chen, J. et al. Nature (2003) 423:33-41. DOI 10.1038/nature01580 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse more

1ORQ is part of these collections:

Ion channels

About this viewer

MolViewer shows 1ORQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.