1ORS: KvAP potassium channel voltage sensor

X-ray structure of the KvAP potassium channel voltage sensor in complex with an Fab. Determined by X-ray diffraction at 1.9 Å resolution. Released 6 May 2003.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Mus musculus, Aeropyrum pernix
Chains: 3
Atoms: 4,771
Mol. weight: 62.08 kDa
Released: 6 May 2003

Explore 1ORS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ORS contains 21 α-helices and 43 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-29	11	1
α-helix	31-33	3
β-strand	35-39	5	2
β-strand	46-50	5	2
β-strand	54-55	2	2
β-strand	63-76	14	1
α-helix	81-83	3
β-strand	85-92	8	2
β-strand	96-98	3	2
β-strand	102-106	5	2
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	164-167	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-198	8	5
β-strand	201-210	10	5
α-helix	211-213	3

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	11-12	2	7
β-strand	18-25	8	6
β-strand	34-40	7	8
β-strand	46-53	8	8
β-strand	58-60	3	8
β-strand	68-73	6	6
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-99	8	8
α-helix	101-103	3
β-strand	105-108	4	8
β-strand	112-114	3	8
β-strand	115-116	2	7
α-helix	119-121	3
β-strand	122	1	9
α-helix	123-124	2
β-strand	125-129	5	10
β-strand	140-150	11	10
β-strand	151	1	9
β-strand	156-159	4	11
α-helix	160-162	3
β-strand	164	1	11
β-strand	168-170	3	10
α-helix	171-173	3
β-strand	174-175	2	10
β-strand	180-189	10	10
β-strand	199-204	6	11
α-helix	205-207	3
β-strand	209-214	6	11

Chain C: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	25-47	23
α-helix	53-79	27
α-helix	91-93	3
α-helix	95-97	3
α-helix	100-112	13
α-helix	116-148	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
33H1 Fab light chain	A	protein	214	Mus musculus	P01837 (AlphaFold model)
33H1 Fab heavy chain	B	protein	221	Mus musculus	P01869 (AlphaFold model)
potassium channel	C	protein	132	Aeropyrum pernix	Q9YDF8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ORS_1 33H1 Fab light chain (chains A)
QIVLTQSPAIMSASLGDRVTMTCTASSSVSSSYLHWYQQKPGSSPKLWIYSTSNLASGVP
ARFSGSGSGTSYSLTISSMEAEDAATYYCHQFHRSLTFGSGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B), FASTA

>1ORS_2 33H1 Fab heavy chain (chains B)
DVQLQESGPGLVKPSQSLSLTCTVTGYSITNNYAWNWIRQFPGNKLEWMGYINYSGTTSY
NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYFCVRGYDYFAMDYWGQGTSVTVSSAK
TTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLY
TLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG

Sequence of entity 3 (C), FASTA

>1ORS_3 potassium channel (chains C)
DVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYK
SGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLS
AIADAADKLVPR

Primary citation

X-ray structure of a voltage-dependent K+ channel. Jiang, Y., Lee, A., Chen, J. et al. Nature (2003) 423:33-41. DOI 10.1038/nature01580 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1ORS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.