1OSP: Outer surface protein A of borrelia burgdorferi

Crystal structure of outer surface protein A of borrelia burgdorferi complexed with a murine monoclonal antibody FAB. Determined by X-ray diffraction at 1.95 Å resolution. Released 21 Apr 1997.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Mus musculus, Borrelia burgdorferi
Chains: 3
Atoms: 5,537
Mol. weight: 74.83 kDa
Released: 21 Apr 1997

Explore 1OSP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OSP contains 19 α-helices and 64 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
α-helix	17	1
β-strand	18-25	8	7
β-strand	34-40	7	9
β-strand	44-51	8	9
α-helix	53-55	3
β-strand	57-59	3	9
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	87-89	3
β-strand	91-98	8	9
β-strand	107-110	4	9
β-strand	114-116	3	9
β-strand	117-118	2	8
α-helix	122-123	2
β-strand	127-131	5	10
β-strand	142-152	11	10
β-strand	158-162	5	11
β-strand	169-178	10	10
β-strand	181-191	11	10
α-helix	192-194	3
β-strand	201-206	6	11
α-helix	207-209	3
β-strand	211-216	6	11

Chain L: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-23	5	3
β-strand	24-25	2	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
β-strand	62-65	4	3
β-strand	71-75	5	3
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	4
α-helix	112-113	2
β-strand	114-118	5	5
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	5
β-strand	140	1	4
β-strand	145-150	6	6
β-strand	153-155	3	6
β-strand	159-163	5	5
α-helix	164-167	4
β-strand	173-182	10	5
α-helix	183-186	4
β-strand	191-197	7	6
α-helix	204	1
β-strand	205-210	6	6

Chain O: 4 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	26-28	3
β-strand	29-33	5	12
α-helix	35-37	3
β-strand	39-43	5	12
β-strand	52-58	7	12
β-strand	61-67	7	12
β-strand	74-79	6	12
β-strand	85-90	6	12
β-strand	96-102	7	12
β-strand	109-116	8	12
β-strand	121-126	6	12
β-strand	132-138	7	12
β-strand	144-148	5	12
β-strand	156-161	6	12
β-strand	166-171	6	12
β-strand	175-182	8	12
β-strand	185-192	8	12
β-strand	197-203	7	12
β-strand	212-217	6	13
α-helix	218-220	3
β-strand	222-227	6	13
β-strand	230-237	8	13
β-strand	243-247	5	13
β-strand	248	1	14
β-strand	255	1	14
β-strand	260-261	2	13
α-helix	265-272	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FAB 184.1	L	protein	214	Mus musculus	P01837 (AlphaFold model)
FAB 184.1	H	protein	218	Mus musculus	P01867 (AlphaFold model)
Outer surface protein A	O	protein	257	Borrelia burgdorferi	P0CL66 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1OSP_1 FAB 184.1 (chains L)
DIQMSQSSSSFSVSLGDRVTITCKASEDIYSRLAWYQQKPGNAPRLLISGATSLETWVPS
RFSGSDSGKDYTLSITSLQTEDVATYFCQQYWSPPPTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1OSP_2 FAB 184.1 (chains H)
EVQLQESGPSLVKPSQTLSLTCSVTGEPITSGFWDWIRKFPGNKLEFMGYIRYGGGTYYN
PSLKSPISITRDTSKNHYYLQLNSVVTEDTATYYCARSRDYYGSSGFAFWGEGTLVTVSA
AKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSG
LYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE

Sequence of entity 3 (O), FASTA

>1OSP_3 OUTER SURFACE PROTEIN A (chains O)
AKQNVSSLDEKNSVSVDLPGEMKVLVSKEKNKDGKYDLIATVDKLELKGTSDKNNGSGVL
EGVKADKCKVKLTISDDLGQTTLEVFKEDGKTLVSKKVTSKDKSSTEEKFNEKGEVSEKI
ITRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGE
VSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTKENTITVQQYDSNGTKLE
GSAVEITKLDEIKNALK

Primary citation

Crystal structure of Lyme disease antigen outer surface protein A complexed with an Fab. Li, H., Dunn, J.J., Luft, B.J. et al. Proc Natl Acad Sci U S A (1997) 94:3584-3589. DOI 10.1073/pnas.94.8.3584 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1OSP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.