1OSX: Extracellular Domain of BLyS Receptor 3

Solution Structure of the Extracellular Domain of BLyS Receptor 3 (BR3). Determined by solution NMR. Released 27 May 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 197
Mol. weight: 6.54 kDa
Released: 27 May 2003

Explore 1OSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OSX contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	1
β-strand	23-26	4	1
β-strand	31-34	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 13C	A	protein	61	Homo sapiens	Q96RJ3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OSX_1 Tumor necrosis factor receptor superfamily member 13C (chains A)
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQ
E

Primary citation

BAFF/BLyS receptor 3 comprises a minimal TNF receptor-like module that encodes a highly focused ligand-binding site. Gordon, N.C., Pan, B., Hymowitz, S.G. et al. Biochemistry (2003) 42:5977-5983. DOI 10.1021/bi034017g · PubMed

Other PDB entries of the same protein (UniProt Q96RJ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OQE 2.5 Å, Crystal structure of sTALL-1 with BAFF-R
8ZUJ 2.58 Å, Pentagonal cluster of BAFF-BAFFR ectodomain complex
2HFG 2.61 Å, Crystal structure of hBR3 bound to CB3s-Fab
8ZUK 2.83 Å, Cluster structure of the BAFF-BAFFR-TRAF3 complex
3V56 3.0 Å, Re-refinement of PDB entry 1OSG - Complex between BAFF and a BR3 derived peptide…
4V46 3.3 Å, Crystal structure of the BAFF-BAFF-R complex
1MPV Structure of bhpBR3, the BAFF-binding loop of BR3 embedded in a beta-hairpin peptide

Browse structure collections

About this viewer

MolViewer shows 1OSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.