1OUZ: Mutant IHF

Crystal structure of a mutant IHF (BetaE44A) complexed with a variant H' Site (T44A). Determined by X-ray diffraction at 2.41 Å resolution. Released 15 Jul 2003.

Method: X-ray diffraction
Resolution: 2.41 Å
Organism: Escherichia coli
Chains: 5
Atoms: 3,101
Mol. weight: 43.48 kDa
Released: 15 Jul 2003

Explore 1OUZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OUZ contains 6 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	5-15	11
α-helix	22-39	18
β-strand	44-46	3	2
β-strand	50-57	8	2
β-strand	60-63	4	3
β-strand	70-73	4	3
β-strand	76-83	8	2
α-helix	85-91	7

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	2
α-helix	3-13	11
α-helix	19-38	20
β-strand	43-45	3	1
β-strand	49-56	8	1
β-strand	59-62	4	4
β-strand	69-72	4	4
β-strand	75-82	8	1
α-helix	84-90	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phage lambda H' site	C	DNA	35
5'-d(gpgpcpcpapapapapapapgpcpaptp*t)-3'	D	DNA	15
5'-d(gpcptptpaptpcpapaptptptpgptpapgpcpapcpc)-3'	E	DNA	20
Integration Host Factor Alpha-subunit	A	protein	99	Escherichia coli	P0A6X7 (AlphaFold model)
Integration Host Factor Beta-subunit	B	protein	94	Escherichia coli	P0A6Y1 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1OUZ_1 Phage lambda H' site (chains C)
CGGTGCTACAAATTGATAAGCAATGCTTTTTTGGC

Sequence of entity 2 (D), FASTA

>1OUZ_2 5'-D(*GP*GP*CP*CP*AP*AP*AP*AP*AP*AP*GP*CP*AP*TP*T)-3' (chains D)
GGCCAAAAAAGCATT

Sequence of entity 3 (E), FASTA

>1OUZ_3 5'-D(*GP*CP*TP*TP*AP*TP*CP*AP*AP*TP*TP*TP*GP*TP*AP*GP*CP*AP*CP*C)-3' (chains E)
GCTTATCAATTTGTAGCACC

Sequence of entity 4 (A), FASTA

>1OUZ_4 Integration Host Factor Alpha-subunit (chains A)
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQR
PGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE

Sequence of entity 5 (B), FASTA

>1OUZ_5 Integration Host Factor Beta-subunit (chains B)
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGSFSLHYRAPRT
GRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

Primary citation

Integration Host Factor: putting a twist on protein-DNA recognition. Lynch, T.W., Read, E.K., Mattis, A.N. et al. J Mol Biol (2003) 330:493-502. DOI 10.1016/S0022-2836(03)00529-1 · PubMed

Other PDB entries of the same protein (UniProt P0A6X7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OWF 1.95 Å, Crystal structure of a mutant IHF (BetaE44A) complexed with the native H' Site
2HT0 2.0 Å, IHF bound to doubly nicked DNA
1OWG 2.1 Å, Crystal structure of WT IHF complexed with an altered H' site (T44A)
2IIE 2.41 Å, single chain Integration Host Factor protein (scIHF2) in complex with DNA
1IHF 2.5 Å, Integration host factor/dna complex
2IIF 2.72 Å, single chain Integration Host Factor mutant protein (scIHF2-K45aE) in complex with DNA
9F10 2.94 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, without accessory…
9F0Z 3.42 Å, CryoEM structure of the F plasmid relaxosome with truncated TraI1-863 in its TE mode,…
9F12 3.42 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_-3ds-2_+143 and TraI…
9F0Y 3.45 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, derived from the…
5WFE 3.64 Å, Cas1-Cas2-IHF-DNA holo-complex
9F11 3.68 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_+3ds+4_+143 and TraI…

Browse structure collections

About this viewer

MolViewer shows 1OUZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.