1OW0: Human FcaRI

Crystal structure of human FcaRI bound to IgA1-Fc. Determined by X-ray diffraction at 3.1 Å resolution. Released 27 May 2003.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,280
Mol. weight: 102.37 kDa
Ligands: NAG
Released: 27 May 2003

Explore 1OW0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OW0 contains 16 α-helices and 74 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	247-249	3	1
α-helix	253-258	6
β-strand	265-268	4	1
β-strand	281	1	2
β-strand	290-291	2	1
β-strand	304-307	4	1
α-helix	312-317	6
β-strand	320-325	6	2
β-strand	334-339	6	2
β-strand	348-352	5	3
α-helix	353-355	3
β-strand	364-374	11	3
β-strand	380-385	6	4
β-strand	388-389	2	4
α-helix	390-391	2
α-helix	392-394	3
β-strand	396-397	2	3
β-strand	401-402	2	3
β-strand	411-420	10	3
α-helix	421-426	6
β-strand	430-435	6	4
β-strand	443-444	2	4
β-strand	447-448	2	4

Chain C: 2 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	9
β-strand	17-19	3	10
β-strand	23-24	2	11
β-strand	26-28	3	9
α-helix	29-30	2
β-strand	36-41	6	12
β-strand	53-54	2	12
β-strand	63	1	9
β-strand	66-67	2	11
β-strand	75-83	9	12
β-strand	87-90	4	12
β-strand	94-96	3	12
β-strand	97-99	3	10
β-strand	106-109	4	13
β-strand	122-126	5	13
β-strand	134-139	6	10
β-strand	148	1	10
β-strand	155-158	4	13
α-helix	164-166	3
β-strand	168-175	8	10
β-strand	182-183	2	10
β-strand	190-192	3	10

Chain D: 2 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	14
β-strand	17-19	3	15
β-strand	23-24	2	16
β-strand	26-28	3	14
α-helix	29-30	2
β-strand	36-41	6	17
β-strand	53-54	2	17
β-strand	63	1	14
β-strand	66-67	2	16
β-strand	75-83	9	17
β-strand	87-90	4	17
β-strand	94-96	3	17
β-strand	97-99	3	15
β-strand	106-109	4	18
β-strand	122-126	5	18
β-strand	134-139	6	15
β-strand	148-150	3	15
β-strand	155-158	4	18
α-helix	164-166	3
β-strand	168-175	8	15
β-strand	182-183	2	15
β-strand	190-192	3	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig alpha-1 chain C region	A, B	protein	214	Homo sapiens	P01876 (AlphaFold model)
Immunoglobulin alpha Fc receptor	C, D	protein	207	Homo sapiens	P24071 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1OW0_1 Ig alpha-1 chain C region (chains A, B)
ACHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCG
CYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELA
LNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVA
AEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGK

Sequence of entity 2 (C, D), FASTA

>1OW0_2 Immunoglobulin alpha Fc receptor (chains C, D)
QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNET
DPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGEN
ISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSP
YLWSFPSNALELVVTAIDGRAHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Insights into IgA-mediated immune responses from the crystal structures of human Fc-alpha-RI and its complex with IgA1-Fc. Herr, A.B., Ballister, E.R., Bjorkman, P.J. Nature (2003) 423:614-620. DOI 10.1038/nature01685 · PubMed

Other PDB entries of the same protein (UniProt P01876 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9R2E 2.54 Å, Structure of ARGX-121 Fab fragment in complex with the Fc fragment of IgA1
9OFR 2.65 Å, Crystal structure of the human IGA1 fc fragment-fc-alpha receptor (CD89) complex
6UE7 2.9 Å, Structure of dimeric sIgA complex
8SKV 3.1 Å, Structure of human SIgA1 in complex with Streptococcus pyogenes protein M4 (Arp4)
6LX3 3.15 Å, Cryo-EM structure of human secretory immunoglobulin A
2QEJ 3.2 Å, Crystal structure of a Staphylococcus aureus protein (SSL7) in complex with Fc of human…
8SKU 3.2 Å, Structure of human SIgA1 in complex with human CD89 (FcaR1)
6LXW 3.27 Å, Cryo-EM structure of human secretory immunoglobulin A in complex with the N-terminal…
9MBZ 3.3 Å, Cryo-EM structure of human FcRL4 bound to IgA-Fc/J
7UVL 3.56 Å, IgA1 Protease with IgA1 substrate
6XJA 4.0 Å, Streptococcus Pneumoniae IgA1 Protease with IgA1 substrate
1IGA Model of human IGA1 determined by solution scattering curve-fitting and homology modelling

Browse structure collections

About this viewer

MolViewer shows 1OW0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.