1OWF: Mutant IHF

Crystal structure of a mutant IHF (BetaE44A) complexed with the native H' Site. Determined by X-ray diffraction at 1.95 Å resolution. Released 15 Jul 2003.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Escherichia coli
Chains: 5
Atoms: 3,097
Mol. weight: 43.48 kDa
Released: 15 Jul 2003

Explore 1OWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OWF contains 7 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	5-16	12
α-helix	20-39	20
β-strand	44-46	3	2
β-strand	50-57	8	2
α-helix	58-59	2
β-strand	60-63	4	3
β-strand	70-73	4	3
β-strand	76-83	8	2
α-helix	85-92	8

Chain B: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	2
α-helix	3-13	11
α-helix	19-38	20
β-strand	43-45	3	1
β-strand	49-56	8	1
β-strand	59-62	4	4
β-strand	69-72	4	4
β-strand	75-82	8	1
α-helix	84-90	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phage lambda H' site	C	DNA	35
5'-d(gpgpcpcpapapapapapapgpcpaptp*t)-3'	D	DNA	15
5'-d(gpcptptpaptpcpapaptptptpgptptpgpcpapcpc)-3'	E	DNA	20
Integration Host Factor Alpha-subunit	A	protein	99	Escherichia coli	P0A6X7 (AlphaFold model)
Integration Host Factor beta-subunit	B	protein	94	Escherichia coli	P0A6Y1 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>1OWF_1 Phage lambda H' site (chains C)
CGGTGCAACAAATTGATAAGCAATGCTTTTTTGGC

Sequence of entity 2 (D), FASTA

>1OWF_2 5'-D(*GP*GP*CP*CP*AP*AP*AP*AP*AP*AP*GP*CP*AP*TP*T)-3' (chains D)
GGCCAAAAAAGCATT

Sequence of entity 3 (E), FASTA

>1OWF_3 5'-D(*GP*CP*TP*TP*AP*TP*CP*AP*AP*TP*TP*TP*GP*TP*TP*GP*CP*AP*CP*C)-3' (chains E)
GCTTATCAATTTGTTGCACC

Sequence of entity 4 (A), FASTA

>1OWF_4 Integration Host Factor Alpha-subunit (chains A)
MALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQR
PGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPKDE

Sequence of entity 5 (B), FASTA

>1OWF_5 Integration Host Factor beta-subunit (chains B)
MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIAIRGFGSFSLHYRAPRT
GRNPKTGDKVELEGKYVPHFKPGKELRDRANIYG

Primary citation

Integration Host Factor: putting a twist on protein-DNA recognition. Lynch, T.W., Read, E.K., Mattis, A.N. et al. J Mol Biol (2003) 330:493-502. DOI 10.1016/S0022-2836(03)00529-1 · PubMed

Other PDB entries of the same protein (UniProt P0A6X7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HT0 2.0 Å, IHF bound to doubly nicked DNA
1OWG 2.1 Å, Crystal structure of WT IHF complexed with an altered H' site (T44A)
1OUZ 2.41 Å, Crystal structure of a mutant IHF (BetaE44A) complexed with a variant H' Site (T44A)
2IIE 2.41 Å, single chain Integration Host Factor protein (scIHF2) in complex with DNA
1IHF 2.5 Å, Integration host factor/dna complex
2IIF 2.72 Å, single chain Integration Host Factor mutant protein (scIHF2-K45aE) in complex with DNA
9F10 2.94 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, without accessory…
9F0Z 3.42 Å, CryoEM structure of the F plasmid relaxosome with truncated TraI1-863 in its TE mode,…
9F12 3.42 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_-3ds-2_+143 and TraI…
9F0Y 3.45 Å, CryoEM structure of the F plasmid relaxosome with TraI in its TE mode, derived from the…
5WFE 3.64 Å, Cas1-Cas2-IHF-DNA holo-complex
9F11 3.68 Å, CryoEM structure of the F plasmid relaxosome with oriT DNA ss-27_+3ds+4_+143 and TraI…

Browse structure collections

About this viewer

MolViewer shows 1OWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.