1OXQ: Baculoviral IAP repeat-containing protein 7
Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP). Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Aug 2003.
- Method
- X-ray diffraction
- Resolution
- 2.3 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 4,409
- Mol. weight
- 80.34 kDa
- Ligands
- P33, ZN
- Released
- 26 Aug 2003
Explore 1OXQ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1OXQ contains 31 α-helices and 20 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 74-75 | 2 | 1 |
| α-helix | 82-85 | 4 | |
| α-helix | 87-92 | 6 | |
| α-helix | 93-96 | 4 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-115 | 3 | 2 |
| β-strand | 122-124 | 3 | 2 |
| β-strand | 130-132 | 3 | 2 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-167 | 16 | |
Chain B: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 74-75 | 2 | 3 |
| α-helix | 82-85 | 4 | |
| α-helix | 87-92 | 6 | |
| α-helix | 93-96 | 4 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-116 | 4 | 4 |
| β-strand | 121-124 | 4 | 4 |
| β-strand | 130-132 | 3 | 4 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-169 | 18 | |
Chain C: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 74-75 | 2 | 4 |
| α-helix | 82-85 | 4 | |
| α-helix | 87-92 | 6 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-115 | 3 | 3 |
| β-strand | 122-124 | 3 | 3 |
| β-strand | 130-132 | 3 | 3 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-169 | 18 | |
Chain D: 8 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 73 | 1 | |
| β-strand | 74-75 | 2 | 2 |
| α-helix | 76 | 1 | |
| α-helix | 82-85 | 4 | |
| α-helix | 87-92 | 6 | |
| α-helix | 93-96 | 4 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-115 | 3 | 1 |
| β-strand | 122-124 | 3 | 1 |
| β-strand | 130-132 | 3 | 1 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-168 | 17 | |
Chain E: 6 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 82-84 | 3 | |
| α-helix | 87-92 | 6 | |
| α-helix | 99-101 | 3 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-115 | 3 | 5 |
| β-strand | 122-124 | 3 | 5 |
| β-strand | 130-132 | 3 | 5 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-168 | 17 | |
Chain F: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-3 | 2 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Baculoviral IAP repeat-containing protein 7 | A, B, C, D, E | protein | 140 | Homo sapiens | Q96CA5 (AlphaFold model) |
| AVPIAQKSE (Smac) peptide | F | protein | 9 | | Q9NR28 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E), FASTA
>1OXQ_1 Baculoviral IAP repeat-containing protein 7 (chains A, B, C, D, E)
MGSSHHHHHHSSGLVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPL
TAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKG
RDFVHSVQETHSQLLGSWDP
Sequence of entity 2 (F), FASTA
>1OXQ_2 AVPIAQKSE (Smac) peptide (chains F)
AVPIAQKSE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| P33 | 3,6,9,12,15,18-hexaoxaicosane-1,20-diol | C14 H30 O8 | 1 |
| ZN | Zinc ion | Zn | 5 |
Primary citation
Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP). Franklin, M.C., Kadkhodayan, S., Ackerly, H. et al. Biochemistry (2003) 42:8223-8231. DOI 10.1021/bi034227t · PubMed
Other PDB entries of the same protein (UniProt Q96CA5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2I3H 1.62 Å, Structure of an ML-IAP/XIAP chimera bound to a 4-mer peptide (AVPW)
- 3GT9 1.7 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 3GTA 1.7 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 3UW5 1.71 Å, Crystal structure of the BIR domain of MLIAP bound to GDC0152
- 1TW6 1.71 Å, Structure of an ML-IAP/XIAP chimera bound to a 9mer peptide derived from Smac
- 3F7H 1.8 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 3F7I 1.9 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 4AUQ 2.18 Å, Structure of BIRC7-UbcH5b-Ub complex.
- 1OXN 2.2 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
- 2I3I 2.3 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 3F7G 2.3 Å, Structure of the BIR domain from ML-IAP bound to a peptidomimetic
- 1OY7 2.7 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
Browse structure collections
About this viewer
MolViewer shows 1OXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.