1OY7: Baculoviral IAP repeat-containing protein 7
Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP). Determined by X-ray diffraction at 2.7 Å resolution. Released 26 Aug 2003.
- Method
- X-ray diffraction
- Resolution
- 2.7 Å
- Organism
- Homo sapiens
- Chains
- 6
- Atoms
- 4,410
- Mol. weight
- 80.33 kDa
- Ligands
- ZN, P33
- Released
- 26 Aug 2003
Explore 1OY7 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1OY7 contains 30 α-helices and 20 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 74-75 | 2 | 1 |
| α-helix | 82-85 | 4 | |
| α-helix | 87-92 | 6 | |
| α-helix | 93-96 | 4 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-115 | 3 | 2 |
| β-strand | 122-124 | 3 | 2 |
| β-strand | 130-132 | 3 | 2 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-167 | 16 | |
Chain B: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 74-75 | 2 | 3 |
| α-helix | 82-85 | 4 | |
| α-helix | 87-92 | 6 | |
| α-helix | 93-96 | 4 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-116 | 4 | 4 |
| β-strand | 121-124 | 4 | 4 |
| β-strand | 130-132 | 3 | 4 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-169 | 18 | |
Chain C: 6 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 74-75 | 2 | 4 |
| α-helix | 82-85 | 4 | |
| α-helix | 87-92 | 6 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-115 | 3 | 3 |
| β-strand | 122-124 | 3 | 3 |
| β-strand | 130-132 | 3 | 3 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-158 | 7 | |
| α-helix | 160-169 | 10 | |
Chain D: 7 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 73 | 1 | |
| β-strand | 74-75 | 2 | 2 |
| α-helix | 76 | 1 | |
| α-helix | 82-85 | 4 | |
| α-helix | 87-92 | 6 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-115 | 3 | 1 |
| β-strand | 122-124 | 3 | 1 |
| β-strand | 130-132 | 3 | 1 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-168 | 17 | |
Chain E: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 82-84 | 3 | |
| α-helix | 87-92 | 6 | |
| α-helix | 105-110 | 6 | |
| β-strand | 113-115 | 3 | 5 |
| β-strand | 122-124 | 3 | 5 |
| β-strand | 130-132 | 3 | 5 |
| α-helix | 140-147 | 8 | |
| α-helix | 152-168 | 17 | |
Chain F: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 2-3 | 2 | 5 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Baculoviral IAP repeat-containing protein 7 | A, B, C, D, E | protein | 140 | Homo sapiens | Q96CA5 (AlphaFold model) |
| AEVVAVKSE peptide | F | protein | 9 | | |
Sequence of entity 1 (A, B, C, D, E), FASTA
>1OY7_1 Baculoviral IAP repeat-containing protein 7 (chains A, B, C, D, E)
MGSSHHHHHHSSGLVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPL
TAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKG
RDFVHSVQETHSQLLGSWDP
Sequence of entity 2 (F), FASTA
>1OY7_2 AEVVAVKSE peptide (chains F)
AEVVAVKSE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 5 |
| P33 | 3,6,9,12,15,18-hexaoxaicosane-1,20-diol | C14 H30 O8 | 1 |
Primary citation
Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of Apoptosis (ML-IAP). Franklin, M.C., Kadkhodayan, S., Ackerly, H. et al. Biochemistry (2003) 42:8223-8231. DOI 10.1021/bi034227t · PubMed
Other PDB entries of the same protein (UniProt Q96CA5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2I3H 1.62 Å, Structure of an ML-IAP/XIAP chimera bound to a 4-mer peptide (AVPW)
- 3GT9 1.7 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 3GTA 1.7 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 3UW5 1.71 Å, Crystal structure of the BIR domain of MLIAP bound to GDC0152
- 1TW6 1.71 Å, Structure of an ML-IAP/XIAP chimera bound to a 9mer peptide derived from Smac
- 3F7H 1.8 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 3F7I 1.9 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 4AUQ 2.18 Å, Structure of BIRC7-UbcH5b-Ub complex.
- 1OXN 2.2 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
- 1OXQ 2.3 Å, Structure and Function Analysis of Peptide Antagonists of Melanoma Inhibitor of…
- 2I3I 2.3 Å, Structure of an ML-IAP/XIAP chimera bound to a peptidomimetic
- 3F7G 2.3 Å, Structure of the BIR domain from ML-IAP bound to a peptidomimetic
Browse structure collections
About this viewer
MolViewer shows 1OY7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.