Three-Dimensional Structure Of a Single Chain Fv Fragment Complexed With The peptide GCN4(7P-14P). Determined by X-ray diffraction at 2.35 Å resolution. Released 4 May 2004.
Explore 1P4B in 3D Show helices and sheets RCSB PDB PDBe
1P4B contains 6 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-11 | 8 | 4 |
| β-strand | 19-26 | 8 | 4 |
| β-strand | 41-46 | 6 | 5 |
| β-strand | 52-58 | 7 | 5 |
| β-strand | 68-70 | 3 | 5 |
| α-helix | 75-77 | 3 | |
| β-strand | 78-83 | 6 | 4 |
| β-strand | 88-93 | 6 | 4 |
| α-helix | 98-100 | 3 | |
| β-strand | 102-107 | 6 | 5 |
| β-strand | 139 | 1 | 5 |
| β-strand | 143-145 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 18-23 | 6 | 3 |
| β-strand | 24-25 | 2 | 1 |
| α-helix | 33-39 | 3 | |
| β-strand | 42-47 | 6 | 2 |
| α-helix | 48-50 | 3 | |
| β-strand | 51-57 | 7 | 2 |
| β-strand | 69-70 | 2 | 2 |
| β-strand | 78-83 | 6 | 3 |
| β-strand | 88-94 | 7 | 3 |
| α-helix | 98-100 | 3 | |
| β-strand | 102-109 | 8 | 2 |
| β-strand | 137-139 | 3 | 2 |
| β-strand | 143-147 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-10 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Antibody Variable light chain | L | protein | 135 | Mus musculus | P01723 (AlphaFold model) |
| Antibody Variable heavy chain | H | protein | 124 | Mus musculus | P01820 (AlphaFold model) |
| GCN4(7P-14P) peptide | P | protein | 12 |
>1P4B_1 Antibody Variable light chain (chains L) MADYADAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGLIGGTNN RAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLGGGGGS GGGGSGGGGSGGGGS
>1P4B_2 Antibody Variable heavy chain (chains H) DVQLQQSGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYN SALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVSSASGADHH HHHH
>1P4B_3 GCN4(7P-14P) peptide (chains P) AHLENEVARLKK
Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity. Zahnd, C., Spinelli, S., Amstutz, P. et al. J Biol Chem (2004) 279:18870-18877. DOI 10.1074/jbc.M309169200 · PubMed
Other PDB entries of the same protein (UniProt P01723 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1P4B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.