Anti-morphine Antibody 9B1 Unliganded Form. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Apr 2004.
Explore 1Q0X in 3D Show helices and sheets RCSB PDB PDBe
1Q0X contains 15 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 6 |
| β-strand | 10-12 | 3 | 7 |
| β-strand | 18-25 | 8 | 6 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-39 | 7 | 7 |
| β-strand | 45-51 | 7 | 7 |
| β-strand | 57-59 | 3 | 7 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 6 |
| β-strand | 77-82 | 6 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 7 |
| β-strand | 100A-103 | 5 | 7 |
| β-strand | 107-111 | 5 | 7 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 8 |
| β-strand | 120-124 | 5 | 9 |
| β-strand | 137-147 | 11 | 9 |
| β-strand | 148 | 1 | 8 |
| β-strand | 153-157 | 4 | 10 |
| α-helix | 158-164 | 3 | |
| β-strand | 166 | 1 | 10 |
| β-strand | 170-173 | 3 | 9 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-179 | 3 | 9 |
| β-strand | 184-194 | 11 | 9 |
| β-strand | 207-212 | 6 | 10 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 9-13 | 4 | 2 |
| β-strand | 19-25 | 7 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 34-39 | 6 | 2 |
| β-strand | 43-49 | 7 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-91 | 8 | 2 |
| β-strand | 96-98 | 3 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 3 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 4 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 129-139 | 11 | 4 |
| β-strand | 140 | 1 | 3 |
| β-strand | 145-150 | 6 | 5 |
| β-strand | 153-155 | 3 | 5 |
| β-strand | 159-161 | 3 | 4 |
| α-helix | 162-164 | 3 | |
| β-strand | 165-166 | 2 | 4 |
| β-strand | 173-182 | 10 | 4 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-198 | 8 | 5 |
| β-strand | 201-210 | 8 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab 9B1, light chain | L | protein | 212 | Mus musculus | P01723 (AlphaFold model) |
| Fab 9B1, heavy chain | H | protein | 221 | Mus musculus | Q9D9B8 (AlphaFold model) |
>1Q0X_1 Fab 9B1, light chain (chains L) DAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGV PARFSGSLIGDKAALTITGAQTEDEAIYFCALWSNNKLVFGGGTKLTVLGQPKSSPTVTL FPPSSEELSTAKATLVCTITDFYPGVVTVDWKVDGTPVTAGMETTQPSKQSNNKYMASSY LTLTARAWERHSSYSCQVTHEGHSSNKTLSRA
>1Q0X_2 Fab 9B1, heavy chain (chains H) EVQLQQSGAELMKPGASVKISCKATGYTFSSYWIEWVKQRPGHGLEWIGEILPGSGDTIF NEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARWVLDYYGMDYWGQGTSLTVSSA STTPPSVYPLAPGGHHHHHHSAMVTLGCLVKGYFPEPVTVVWNKGSLSTGTHTFPAVLAA DLYTLSSSVTVSASSWPGQSVTCNVAHPASSTKVDKKIAPS
Anchoring a cationic ligand: the structure of the Fab fragment of the anti-morphine antibody 9B1 and its complex with morphine. Pozharski, E., Wilson, M.A., Hewagama, A. et al. J Mol Biol (2004) 337:691-697. DOI 10.1016/j.jmb.2003.12.084 · PubMed
Other PDB entries of the same protein (UniProt P01723 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1Q0X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.