Solution Structure of the Pleckstrin Homology Domain of Human Protein Kinase B beta (Pkb/Akt). Determined by solution NMR. Released 18 May 2004.
Explore 1P6S in 3D Show helices and sheets RCSB PDB PDBe
1P6S contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-15 | 10 | 1 |
| β-strand | 22-30 | 9 | 1 |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 49-51 | 3 | |
| β-strand | 53-56 | 4 | 1 |
| β-strand | 62-65 | 4 | 1 |
| β-strand | 72-75 | 4 | 1 |
| β-strand | 87-90 | 4 | 1 |
| α-helix | 93-110 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RAC-beta serine/threonine protein kinase | A | protein | 111 | Homo sapiens | P31751 (AlphaFold model) |
>1P6S_1 RAC-beta serine/threonine protein kinase (chains A) MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLK
Solution structure and backbone dynamics of the pleckstrin homology domain of the human protein kinase B (PKB/Akt). Interaction with inositol phosphates. Auguin, D., Barthe, P., Auge-Senegas, M.T. et al. J Biomol NMR (2004) 28:137-155. DOI 10.1023/B:JNMR.0000013836.62154.c2 · PubMed
Other PDB entries of the same protein (UniProt P31751 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1P6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.